BLASTX nr result
ID: Cocculus22_contig00032042
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00032042 (329 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI19209.3| unnamed protein product [Vitis vinifera] 58 1e-06 >emb|CBI19209.3| unnamed protein product [Vitis vinifera] Length = 219 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 4/47 (8%) Frame = +3 Query: 201 DGTVHSST----NATSGPPSNSWRNWILGALFSIILPFWKHKWAPLL 329 D TV+ ST + SGPP+NSW+NWI+G L S+++P WK+K PLL Sbjct: 68 DTTVYCSTQPGASLPSGPPTNSWKNWIIGMLLSMVVPLWKYKLGPLL 114