BLASTX nr result
ID: Cocculus22_contig00031956
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00031956 (290 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006848399.1| hypothetical protein AMTR_s00013p00220950 [A... 100 2e-19 ref|XP_002279240.1| PREDICTED: endoplasmic reticulum metallopept... 100 4e-19 emb|CAN74144.1| hypothetical protein VITISV_011748 [Vitis vinifera] 100 4e-19 ref|XP_002314531.2| hypothetical protein POPTR_0010s07030g [Popu... 97 2e-18 ref|XP_002314638.2| hypothetical protein POPTR_0010s07030g [Popu... 97 2e-18 gb|EYU42098.1| hypothetical protein MIMGU_mgv1a001167mg [Mimulus... 97 3e-18 ref|XP_006484085.1| PREDICTED: endoplasmic reticulum metallopept... 96 7e-18 ref|XP_006438048.1| hypothetical protein CICLE_v10030679mg [Citr... 94 3e-17 ref|XP_006438047.1| hypothetical protein CICLE_v10030679mg [Citr... 94 3e-17 ref|XP_002514927.1| protein with unknown function [Ricinus commu... 90 3e-16 ref|XP_006343167.1| PREDICTED: endoplasmic reticulum metallopept... 90 4e-16 ref|XP_002312621.2| hypothetical protein POPTR_0008s17550g [Popu... 89 6e-16 ref|XP_004252217.1| PREDICTED: endoplasmic reticulum metallopept... 86 7e-15 ref|XP_004158256.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmic ... 86 7e-15 ref|XP_004144197.1| PREDICTED: endoplasmic reticulum metallopept... 86 7e-15 gb|EXC06150.1| Endoplasmic reticulum metallopeptidase 1 [Morus n... 85 9e-15 ref|XP_004310069.1| PREDICTED: endoplasmic reticulum metallopept... 82 6e-14 gb|AAC18795.1| Contains similarity to hypothetical gene B0495.7 ... 81 1e-13 ref|NP_001185342.1| Zn-dependent exopeptidase-like protein [Arab... 81 1e-13 ref|NP_176909.3| Zn-dependent exopeptidase-like protein [Arabido... 81 1e-13 >ref|XP_006848399.1| hypothetical protein AMTR_s00013p00220950 [Amborella trichopoda] gi|548851705|gb|ERN09980.1| hypothetical protein AMTR_s00013p00220950 [Amborella trichopoda] Length = 846 Score = 100 bits (249), Expect = 2e-19 Identities = 45/85 (52%), Positives = 63/85 (74%) Frame = -3 Query: 258 SSSSELQNVHERTSLSHGASGNQGDRAVFFDYLSWFMVFYSRRQALLFHSLPAVIFLLMP 79 ++SSELQN +R S +G++ DRAVFFDYL+WFM+FY+R++AL+ HSLP V+ LL+P Sbjct: 303 ANSSELQNAQQRASAGDVRNGSKNDRAVFFDYLTWFMIFYTRKEALVLHSLPMVVLLLVP 362 Query: 78 FLLNYPNIEVHSLFATFCDFGKGVL 4 F LN+ N+ V S F F + KG+L Sbjct: 363 FFLNFSNVGVSSWFGMFLEMIKGLL 387 >ref|XP_002279240.1| PREDICTED: endoplasmic reticulum metallopeptidase 1 [Vitis vinifera] gi|297738431|emb|CBI27632.3| unnamed protein product [Vitis vinifera] Length = 873 Score = 99.8 bits (247), Expect = 4e-19 Identities = 49/85 (57%), Positives = 63/85 (74%) Frame = -3 Query: 258 SSSSELQNVHERTSLSHGASGNQGDRAVFFDYLSWFMVFYSRRQALLFHSLPAVIFLLMP 79 ++SS+L N HER SL A+ + +RAVFFDYLSWFM+FYSRR A++ H++P IFLLMP Sbjct: 328 ANSSKLLNAHERESLKVAANEPKDERAVFFDYLSWFMIFYSRRAAVVLHTIPIAIFLLMP 387 Query: 78 FLLNYPNIEVHSLFATFCDFGKGVL 4 FLL NI + F+TF DF KG+L Sbjct: 388 FLLFVLNIGKRTWFSTFYDFFKGLL 412 >emb|CAN74144.1| hypothetical protein VITISV_011748 [Vitis vinifera] Length = 829 Score = 99.8 bits (247), Expect = 4e-19 Identities = 49/85 (57%), Positives = 63/85 (74%) Frame = -3 Query: 258 SSSSELQNVHERTSLSHGASGNQGDRAVFFDYLSWFMVFYSRRQALLFHSLPAVIFLLMP 79 ++SS+L N HER SL A+ + +RAVFFDYLSWFM+FYSRR A++ H++P IFLLMP Sbjct: 328 ANSSKLLNAHERESLKVAANEPKDERAVFFDYLSWFMIFYSRRAAVVLHTIPIAIFLLMP 387 Query: 78 FLLNYPNIEVHSLFATFCDFGKGVL 4 FLL NI + F+TF DF KG+L Sbjct: 388 FLLFVLNIGKRTWFSTFYDFFKGLL 412 >ref|XP_002314531.2| hypothetical protein POPTR_0010s07030g [Populus trichocarpa] gi|550329263|gb|EEF00702.2| hypothetical protein POPTR_0010s07030g [Populus trichocarpa] Length = 871 Score = 97.1 bits (240), Expect = 2e-18 Identities = 47/86 (54%), Positives = 64/86 (74%) Frame = -3 Query: 258 SSSSELQNVHERTSLSHGASGNQGDRAVFFDYLSWFMVFYSRRQALLFHSLPAVIFLLMP 79 ++SS+LQ+ ER L + + +RAVFFD+LSWF++FYSRR AL+ HS+P VIFL+MP Sbjct: 326 TNSSKLQSAREREYLKASINDYKDERAVFFDFLSWFIIFYSRRVALVLHSIPIVIFLVMP 385 Query: 78 FLLNYPNIEVHSLFATFCDFGKGVLF 1 FLL++ + S FATF DF KG+LF Sbjct: 386 FLLHFWDSRSRSCFATFYDFLKGMLF 411 >ref|XP_002314638.2| hypothetical protein POPTR_0010s07030g [Populus trichocarpa] gi|550329262|gb|EEF00809.2| hypothetical protein POPTR_0010s07030g [Populus trichocarpa] Length = 760 Score = 97.1 bits (240), Expect = 2e-18 Identities = 47/86 (54%), Positives = 64/86 (74%) Frame = -3 Query: 258 SSSSELQNVHERTSLSHGASGNQGDRAVFFDYLSWFMVFYSRRQALLFHSLPAVIFLLMP 79 ++SS+LQ+ ER L + + +RAVFFD+LSWF++FYSRR AL+ HS+P VIFL+MP Sbjct: 215 TNSSKLQSAREREYLKASINDYKDERAVFFDFLSWFIIFYSRRVALVLHSIPIVIFLVMP 274 Query: 78 FLLNYPNIEVHSLFATFCDFGKGVLF 1 FLL++ + S FATF DF KG+LF Sbjct: 275 FLLHFWDSRSRSCFATFYDFLKGMLF 300 >gb|EYU42098.1| hypothetical protein MIMGU_mgv1a001167mg [Mimulus guttatus] Length = 873 Score = 96.7 bits (239), Expect = 3e-18 Identities = 46/86 (53%), Positives = 60/86 (69%) Frame = -3 Query: 258 SSSSELQNVHERTSLSHGASGNQGDRAVFFDYLSWFMVFYSRRQALLFHSLPAVIFLLMP 79 ++SS+L ER S G++G+R VFFDY + FMVFYSR+QAL+FHS+P IFLLMP Sbjct: 329 ANSSKLLTAQERESFRAAGGGSKGERPVFFDYFAQFMVFYSRKQALVFHSIPLAIFLLMP 388 Query: 78 FLLNYPNIEVHSLFATFCDFGKGVLF 1 LL PN + F ++CDF KG+LF Sbjct: 389 VLLRLPNGSLLRSFRSYCDFFKGLLF 414 >ref|XP_006484085.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Citrus sinensis] Length = 873 Score = 95.5 bits (236), Expect = 7e-18 Identities = 42/85 (49%), Positives = 60/85 (70%) Frame = -3 Query: 258 SSSSELQNVHERTSLSHGASGNQGDRAVFFDYLSWFMVFYSRRQALLFHSLPAVIFLLMP 79 S+SS+LQN H+R S N+ +RA+FFDYL+WFM++YSR +A + H +P VIF+ +P Sbjct: 328 SNSSKLQNAHDRASFEATGIKNKDERAIFFDYLTWFMIYYSRSRATVLHGIPIVIFITVP 387 Query: 78 FLLNYPNIEVHSLFATFCDFGKGVL 4 F L N +HS FAT+ DF KG++ Sbjct: 388 FFLRLLNSGLHSWFATYSDFVKGMM 412 >ref|XP_006438048.1| hypothetical protein CICLE_v10030679mg [Citrus clementina] gi|557540244|gb|ESR51288.1| hypothetical protein CICLE_v10030679mg [Citrus clementina] Length = 796 Score = 93.6 bits (231), Expect = 3e-17 Identities = 42/85 (49%), Positives = 59/85 (69%) Frame = -3 Query: 258 SSSSELQNVHERTSLSHGASGNQGDRAVFFDYLSWFMVFYSRRQALLFHSLPAVIFLLMP 79 S+SS+LQN H+R S N +RA+FFDYL+WFM++YSR +A + H +P VIF+ +P Sbjct: 328 SNSSKLQNAHDRASFEATGIKNTDERAIFFDYLTWFMIYYSRSRATVLHWIPIVIFITVP 387 Query: 78 FLLNYPNIEVHSLFATFCDFGKGVL 4 F L N +HS FAT+ DF KG++ Sbjct: 388 FFLRLLNSGLHSWFATYSDFVKGMM 412 >ref|XP_006438047.1| hypothetical protein CICLE_v10030679mg [Citrus clementina] gi|557540243|gb|ESR51287.1| hypothetical protein CICLE_v10030679mg [Citrus clementina] Length = 873 Score = 93.6 bits (231), Expect = 3e-17 Identities = 42/85 (49%), Positives = 59/85 (69%) Frame = -3 Query: 258 SSSSELQNVHERTSLSHGASGNQGDRAVFFDYLSWFMVFYSRRQALLFHSLPAVIFLLMP 79 S+SS+LQN H+R S N +RA+FFDYL+WFM++YSR +A + H +P VIF+ +P Sbjct: 328 SNSSKLQNAHDRASFEATGIKNTDERAIFFDYLTWFMIYYSRSRATVLHWIPIVIFITVP 387 Query: 78 FLLNYPNIEVHSLFATFCDFGKGVL 4 F L N +HS FAT+ DF KG++ Sbjct: 388 FFLRLLNSGLHSWFATYSDFVKGMM 412 >ref|XP_002514927.1| protein with unknown function [Ricinus communis] gi|223545978|gb|EEF47481.1| protein with unknown function [Ricinus communis] Length = 1086 Score = 90.1 bits (222), Expect = 3e-16 Identities = 44/85 (51%), Positives = 59/85 (69%) Frame = -3 Query: 258 SSSSELQNVHERTSLSHGASGNQGDRAVFFDYLSWFMVFYSRRQALLFHSLPAVIFLLMP 79 ++SS+L+ ER SL ++ + +RAVFFDYLSWFM+FYSRR +L+ HS+P IF +MP Sbjct: 326 TNSSKLRTAQERESLRATSNDYKDERAVFFDYLSWFMIFYSRRVSLVLHSIPIAIFFVMP 385 Query: 78 FLLNYPNIEVHSLFATFCDFGKGVL 4 F L + + S FATF DF KG L Sbjct: 386 FFLRLLDSGLQSSFATFYDFVKGFL 410 >ref|XP_006343167.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Solanum tuberosum] Length = 872 Score = 89.7 bits (221), Expect = 4e-16 Identities = 45/85 (52%), Positives = 59/85 (69%) Frame = -3 Query: 258 SSSSELQNVHERTSLSHGASGNQGDRAVFFDYLSWFMVFYSRRQALLFHSLPAVIFLLMP 79 ++SS LQN H+R L + + +RAVFFDYLS F+V+YSR+QA+ HSLP VIF L+P Sbjct: 328 TNSSNLQNAHQRR-LRSAVNRSDNERAVFFDYLSCFLVYYSRKQAMFLHSLPVVIFFLVP 386 Query: 78 FLLNYPNIEVHSLFATFCDFGKGVL 4 LL +P + FATF DF KG+L Sbjct: 387 LLLRFPTWGLTCCFATFYDFLKGML 411 >ref|XP_002312621.2| hypothetical protein POPTR_0008s17550g [Populus trichocarpa] gi|550333306|gb|EEE89988.2| hypothetical protein POPTR_0008s17550g [Populus trichocarpa] Length = 870 Score = 89.0 bits (219), Expect = 6e-16 Identities = 44/86 (51%), Positives = 62/86 (72%) Frame = -3 Query: 258 SSSSELQNVHERTSLSHGASGNQGDRAVFFDYLSWFMVFYSRRQALLFHSLPAVIFLLMP 79 ++SS+LQ+ ER S + + + +RAVFFDYLSWF++FYSRR A++ HS+P IF +MP Sbjct: 326 TNSSKLQSARERESKAT-TNDYKDERAVFFDYLSWFLIFYSRRVAVVLHSIPIAIFFVMP 384 Query: 78 FLLNYPNIEVHSLFATFCDFGKGVLF 1 FLL++ + S FA F DF KG+LF Sbjct: 385 FLLHFWDSRSRSCFAIFYDFVKGLLF 410 >ref|XP_004252217.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Solanum lycopersicum] Length = 862 Score = 85.5 bits (210), Expect = 7e-15 Identities = 42/85 (49%), Positives = 57/85 (67%) Frame = -3 Query: 258 SSSSELQNVHERTSLSHGASGNQGDRAVFFDYLSWFMVFYSRRQALLFHSLPAVIFLLMP 79 ++SS LQN H+R L + + +RA+FFDYLS F+V+YSR+QA+ H LP VIF L+P Sbjct: 328 TNSSNLQNAHQR-KLRSAVNRSDNERAIFFDYLSCFLVYYSRKQAMFLHCLPVVIFFLVP 386 Query: 78 FLLNYPNIEVHSLFATFCDFGKGVL 4 LL +P + FA F DF KG+L Sbjct: 387 LLLRFPTWGLTYCFAAFYDFLKGML 411 >ref|XP_004158256.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmic reticulum metallopeptidase 1-like [Cucumis sativus] Length = 872 Score = 85.5 bits (210), Expect = 7e-15 Identities = 42/85 (49%), Positives = 54/85 (63%) Frame = -3 Query: 258 SSSSELQNVHERTSLSHGASGNQGDRAVFFDYLSWFMVFYSRRQALLFHSLPAVIFLLMP 79 ++SS LQN ++ S + D A+FFDYLSWFMVFYSRR AL+ H +P +F++MP Sbjct: 328 TNSSMLQNFYKLASSEITIHQEKDDGAIFFDYLSWFMVFYSRRLALILHKVPLAVFVVMP 387 Query: 78 FLLNYPNIEVHSLFATFCDFGKGVL 4 FLLN + S ATF D KG L Sbjct: 388 FLLNLRKFSMTSCLATFSDLTKGFL 412 >ref|XP_004144197.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Cucumis sativus] Length = 872 Score = 85.5 bits (210), Expect = 7e-15 Identities = 42/85 (49%), Positives = 54/85 (63%) Frame = -3 Query: 258 SSSSELQNVHERTSLSHGASGNQGDRAVFFDYLSWFMVFYSRRQALLFHSLPAVIFLLMP 79 ++SS LQN ++ S + D A+FFDYLSWFMVFYSRR AL+ H +P +F++MP Sbjct: 328 TNSSMLQNFYKLASSEITIHQEKDDGAIFFDYLSWFMVFYSRRLALILHKVPLAVFVVMP 387 Query: 78 FLLNYPNIEVHSLFATFCDFGKGVL 4 FLLN + S ATF D KG L Sbjct: 388 FLLNLRKFSMTSCLATFSDLTKGFL 412 >gb|EXC06150.1| Endoplasmic reticulum metallopeptidase 1 [Morus notabilis] Length = 872 Score = 85.1 bits (209), Expect = 9e-15 Identities = 42/86 (48%), Positives = 60/86 (69%) Frame = -3 Query: 258 SSSSELQNVHERTSLSHGASGNQGDRAVFFDYLSWFMVFYSRRQALLFHSLPAVIFLLMP 79 ++SS+L+ HER S + + +RAVFFDYL+WFM++YSRR ALL H++P IF +MP Sbjct: 328 ANSSKLKTAHERESHEATTNSEKIERAVFFDYLTWFMIYYSRRVALLLHNIPLAIFFIMP 387 Query: 78 FLLNYPNIEVHSLFATFCDFGKGVLF 1 +L+ + + S FAT DF KG+LF Sbjct: 388 -VLHLRSSGLRSCFATLFDFMKGMLF 412 >ref|XP_004310069.1| PREDICTED: endoplasmic reticulum metallopeptidase 1-like [Fragaria vesca subsp. vesca] Length = 869 Score = 82.4 bits (202), Expect = 6e-14 Identities = 42/86 (48%), Positives = 55/86 (63%) Frame = -3 Query: 258 SSSSELQNVHERTSLSHGASGNQGDRAVFFDYLSWFMVFYSRRQALLFHSLPAVIFLLMP 79 ++SS+LQN ER S + RAVFFDYL+WFM++YSR+ A++ H +P IFL MP Sbjct: 324 TNSSKLQNTLERHSNLSTTKQQEVGRAVFFDYLTWFMIYYSRKVAMVLHHIPIGIFLAMP 383 Query: 78 FLLNYPNIEVHSLFATFCDFGKGVLF 1 F N + S FATF F KG+LF Sbjct: 384 FFSQKQNSGLLSWFATFSSFVKGMLF 409 >gb|AAC18795.1| Contains similarity to hypothetical gene B0495.7 gb|687822 from C. elegans cosmid gb|U21317 [Arabidopsis thaliana] Length = 840 Score = 81.3 bits (199), Expect = 1e-13 Identities = 40/85 (47%), Positives = 55/85 (64%) Frame = -3 Query: 258 SSSSELQNVHERTSLSHGASGNQGDRAVFFDYLSWFMVFYSRRQALLFHSLPAVIFLLMP 79 +SSS L+ ER +L A+ + +RAVFFDYL+WFMVFY RR A + H++PA +FL +P Sbjct: 332 ASSSRLKVASERKTLDVDANSDMVERAVFFDYLTWFMVFYPRRVAFVLHNIPAALFLCVP 391 Query: 78 FLLNYPNIEVHSLFATFCDFGKGVL 4 F L + H L + F F KGV+ Sbjct: 392 FFLYMMDPRTHPLLSFFWAFFKGVM 416 >ref|NP_001185342.1| Zn-dependent exopeptidase-like protein [Arabidopsis thaliana] gi|332196522|gb|AEE34643.1| Zn-dependent exopeptidase-like protein [Arabidopsis thaliana] Length = 922 Score = 81.3 bits (199), Expect = 1e-13 Identities = 40/85 (47%), Positives = 55/85 (64%) Frame = -3 Query: 258 SSSSELQNVHERTSLSHGASGNQGDRAVFFDYLSWFMVFYSRRQALLFHSLPAVIFLLMP 79 +SSS L+ ER +L A+ + +RAVFFDYL+WFMVFY RR A + H++PA +FL +P Sbjct: 378 ASSSRLKVASERKTLDVDANSDMVERAVFFDYLTWFMVFYPRRVAFVLHNIPAALFLCVP 437 Query: 78 FLLNYPNIEVHSLFATFCDFGKGVL 4 F L + H L + F F KGV+ Sbjct: 438 FFLYMMDPRTHPLLSFFWAFFKGVM 462 >ref|NP_176909.3| Zn-dependent exopeptidase-like protein [Arabidopsis thaliana] gi|332196521|gb|AEE34642.1| Zn-dependent exopeptidase-like protein [Arabidopsis thaliana] Length = 872 Score = 81.3 bits (199), Expect = 1e-13 Identities = 40/85 (47%), Positives = 55/85 (64%) Frame = -3 Query: 258 SSSSELQNVHERTSLSHGASGNQGDRAVFFDYLSWFMVFYSRRQALLFHSLPAVIFLLMP 79 +SSS L+ ER +L A+ + +RAVFFDYL+WFMVFY RR A + H++PA +FL +P Sbjct: 329 ASSSRLKVASERKTLDVDANSDMVERAVFFDYLTWFMVFYPRRVAFVLHNIPAALFLCVP 388 Query: 78 FLLNYPNIEVHSLFATFCDFGKGVL 4 F L + H L + F F KGV+ Sbjct: 389 FFLYMMDPRTHPLLSFFWAFFKGVM 413