BLASTX nr result
ID: Cocculus22_contig00031747
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00031747 (308 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB44697.1| GDSL esterase/lipase [Morus notabilis] 77 2e-12 gb|AFK41800.1| unknown [Medicago truncatula] 77 2e-12 ref|XP_006477462.1| PREDICTED: GDSL esterase/lipase At1g74460-li... 77 3e-12 ref|XP_004514956.1| PREDICTED: GDSL esterase/lipase At1g74460-li... 76 6e-12 ref|XP_004236009.1| PREDICTED: GDSL esterase/lipase At1g74460-li... 76 6e-12 ref|XP_007037375.1| GDSL-like Lipase/Acylhydrolase superfamily p... 75 7e-12 ref|XP_004138168.1| PREDICTED: GDSL esterase/lipase At1g74460-li... 75 7e-12 ref|XP_006364591.1| PREDICTED: GDSL esterase/lipase At1g74460-li... 75 9e-12 ref|XP_006440607.1| hypothetical protein CICLE_v10023301mg [Citr... 74 2e-11 ref|XP_002318602.1| hypothetical protein POPTR_0012s07050g [Popu... 74 2e-11 ref|XP_002514748.1| zinc finger protein, putative [Ricinus commu... 73 4e-11 ref|XP_006581972.1| PREDICTED: GDSL esterase/lipase At1g74460-li... 73 5e-11 ref|XP_003523018.1| PREDICTED: GDSL esterase/lipase At1g74460-li... 73 5e-11 gb|EYU24367.1| hypothetical protein MIMGU_mgv1a026492mg, partial... 72 8e-11 ref|XP_002284894.2| PREDICTED: GDSL esterase/lipase At1g74460-li... 72 8e-11 ref|XP_004508729.1| PREDICTED: GDSL esterase/lipase At1g74460-li... 71 1e-10 ref|XP_007138177.1| hypothetical protein PHAVU_009G186800g [Phas... 71 2e-10 ref|XP_007155304.1| hypothetical protein PHAVU_003G189500g [Phas... 70 2e-10 ref|XP_004965047.1| PREDICTED: GDSL esterase/lipase At1g74460-li... 69 5e-10 ref|XP_007209292.1| hypothetical protein PRUPE_ppa007718mg [Prun... 69 7e-10 >gb|EXB44697.1| GDSL esterase/lipase [Morus notabilis] Length = 369 Score = 77.0 bits (188), Expect = 2e-12 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = +1 Query: 1 PLSTLCSDRSKYVFWDEYHPSDKANEMIANEIIRKLGFL 117 P STLC DRSKYVFWDEYHPSD ANE+IANEII+KLGFL Sbjct: 311 PASTLCKDRSKYVFWDEYHPSDAANEIIANEIIKKLGFL 349 >gb|AFK41800.1| unknown [Medicago truncatula] Length = 368 Score = 77.0 bits (188), Expect = 2e-12 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = +1 Query: 1 PLSTLCSDRSKYVFWDEYHPSDKANEMIANEIIRKLGFL 117 P STLCSDRSKYVFWDEYHPSD ANE+IANE+I+K GFL Sbjct: 309 PASTLCSDRSKYVFWDEYHPSDSANELIANELIKKFGFL 347 >ref|XP_006477462.1| PREDICTED: GDSL esterase/lipase At1g74460-like [Citrus sinensis] Length = 369 Score = 76.6 bits (187), Expect = 3e-12 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = +1 Query: 1 PLSTLCSDRSKYVFWDEYHPSDKANEMIANEIIRKLGFL 117 P STLC+DRSKYVFWDEYHPSD ANE++ANE+I+KLGFL Sbjct: 309 PASTLCNDRSKYVFWDEYHPSDAANELVANELIKKLGFL 347 >ref|XP_004514956.1| PREDICTED: GDSL esterase/lipase At1g74460-like [Cicer arietinum] Length = 363 Score = 75.9 bits (185), Expect = 6e-12 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +1 Query: 1 PLSTLCSDRSKYVFWDEYHPSDKANEMIANEIIRKLGF 114 P STLC DRSKYVFWDEYHPSDKANE+IANE+I+K GF Sbjct: 309 PASTLCKDRSKYVFWDEYHPSDKANELIANELIKKFGF 346 >ref|XP_004236009.1| PREDICTED: GDSL esterase/lipase At1g74460-like [Solanum lycopersicum] Length = 366 Score = 75.9 bits (185), Expect = 6e-12 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = +1 Query: 1 PLSTLCSDRSKYVFWDEYHPSDKANEMIANEIIRKLGFL 117 P STLCSDRSKYVFWDEYHPSD+AN++IA E+I+KLGFL Sbjct: 305 PASTLCSDRSKYVFWDEYHPSDRANQLIAKELIKKLGFL 343 >ref|XP_007037375.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma cacao] gi|508774620|gb|EOY21876.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma cacao] Length = 423 Score = 75.5 bits (184), Expect = 7e-12 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +1 Query: 1 PLSTLCSDRSKYVFWDEYHPSDKANEMIANEIIRKLGFL 117 P STLC DRSKYVFWDEYHPSD ANE+IANE+I+K GFL Sbjct: 364 PTSTLCEDRSKYVFWDEYHPSDSANELIANELIKKFGFL 402 >ref|XP_004138168.1| PREDICTED: GDSL esterase/lipase At1g74460-like [Cucumis sativus] gi|449477249|ref|XP_004154971.1| PREDICTED: GDSL esterase/lipase At1g74460-like [Cucumis sativus] Length = 383 Score = 75.5 bits (184), Expect = 7e-12 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +1 Query: 1 PLSTLCSDRSKYVFWDEYHPSDKANEMIANEIIRKLGFL 117 P S LC DRSKYVFWDEYHPSDKANE+IANE+I+K GFL Sbjct: 308 PASVLCKDRSKYVFWDEYHPSDKANELIANELIKKFGFL 346 >ref|XP_006364591.1| PREDICTED: GDSL esterase/lipase At1g74460-like [Solanum tuberosum] Length = 366 Score = 75.1 bits (183), Expect = 9e-12 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = +1 Query: 1 PLSTLCSDRSKYVFWDEYHPSDKANEMIANEIIRKLGFL 117 P STLCSDRSKYVFWDEYHPSD AN++IA E+I+KLGFL Sbjct: 305 PASTLCSDRSKYVFWDEYHPSDSANQLIAKELIKKLGFL 343 >ref|XP_006440607.1| hypothetical protein CICLE_v10023301mg [Citrus clementina] gi|557542869|gb|ESR53847.1| hypothetical protein CICLE_v10023301mg [Citrus clementina] Length = 369 Score = 73.9 bits (180), Expect = 2e-11 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +1 Query: 1 PLSTLCSDRSKYVFWDEYHPSDKANEMIANEIIRKLGFL 117 P S LC DRSKYVFWDEYHPSD ANE++ANE+I+KLGFL Sbjct: 309 PASILCKDRSKYVFWDEYHPSDAANELVANELIKKLGFL 347 >ref|XP_002318602.1| hypothetical protein POPTR_0012s07050g [Populus trichocarpa] gi|222859275|gb|EEE96822.1| hypothetical protein POPTR_0012s07050g [Populus trichocarpa] Length = 378 Score = 73.9 bits (180), Expect = 2e-11 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +1 Query: 1 PLSTLCSDRSKYVFWDEYHPSDKANEMIANEIIRKLGF 114 P STLC DRSKYVFWDEYHPSD ANE+IANE+I+K GF Sbjct: 311 PASTLCEDRSKYVFWDEYHPSDSANELIANELIKKFGF 348 >ref|XP_002514748.1| zinc finger protein, putative [Ricinus communis] gi|223546352|gb|EEF47854.1| zinc finger protein, putative [Ricinus communis] Length = 366 Score = 73.2 bits (178), Expect = 4e-11 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +1 Query: 1 PLSTLCSDRSKYVFWDEYHPSDKANEMIANEIIRKLGFL 117 P STLC DRSKYVFWDEYHPSD AN +IANE+I+K GFL Sbjct: 309 PASTLCKDRSKYVFWDEYHPSDSANALIANELIKKFGFL 347 >ref|XP_006581972.1| PREDICTED: GDSL esterase/lipase At1g74460-like [Glycine max] Length = 367 Score = 72.8 bits (177), Expect = 5e-11 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = +1 Query: 1 PLSTLCSDRSKYVFWDEYHPSDKANEMIANEIIRKLGFL 117 P S LC DRSKYVFWDEYHPSD+ANE+IANE+I+K GF+ Sbjct: 309 PASKLCKDRSKYVFWDEYHPSDRANELIANELIKKFGFV 347 >ref|XP_003523018.1| PREDICTED: GDSL esterase/lipase At1g74460-like [Glycine max] Length = 367 Score = 72.8 bits (177), Expect = 5e-11 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = +1 Query: 1 PLSTLCSDRSKYVFWDEYHPSDKANEMIANEIIRKLGFL 117 P S LC DRSKYVFWDEYHPSD+ANE+IANE+I+K GF+ Sbjct: 309 PASKLCKDRSKYVFWDEYHPSDRANELIANELIKKFGFV 347 >gb|EYU24367.1| hypothetical protein MIMGU_mgv1a026492mg, partial [Mimulus guttatus] Length = 287 Score = 72.0 bits (175), Expect = 8e-11 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +1 Query: 1 PLSTLCSDRSKYVFWDEYHPSDKANEMIANEIIRKLGF 114 P S LC DRSKYVFWDEYHPSD AN++IANE+I+KLGF Sbjct: 229 PASILCKDRSKYVFWDEYHPSDNANQLIANELIKKLGF 266 >ref|XP_002284894.2| PREDICTED: GDSL esterase/lipase At1g74460-like [Vitis vinifera] gi|297733969|emb|CBI15216.3| unnamed protein product [Vitis vinifera] Length = 385 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = +1 Query: 1 PLSTLCSDRSKYVFWDEYHPSDKANEMIANEIIRKLGFL 117 P S LC DRSKYVFWDEYHPSD ANE+IA E+IRK GFL Sbjct: 309 PASILCEDRSKYVFWDEYHPSDSANELIATELIRKFGFL 347 >ref|XP_004508729.1| PREDICTED: GDSL esterase/lipase At1g74460-like [Cicer arietinum] Length = 385 Score = 71.2 bits (173), Expect = 1e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +1 Query: 1 PLSTLCSDRSKYVFWDEYHPSDKANEMIANEIIRKLGF 114 P S LCSDRSKYVFWDEYHPSD AN++IANE+I K GF Sbjct: 311 PASILCSDRSKYVFWDEYHPSDSANQLIANELIHKFGF 348 >ref|XP_007138177.1| hypothetical protein PHAVU_009G186800g [Phaseolus vulgaris] gi|561011264|gb|ESW10171.1| hypothetical protein PHAVU_009G186800g [Phaseolus vulgaris] Length = 367 Score = 70.9 bits (172), Expect = 2e-10 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +1 Query: 1 PLSTLCSDRSKYVFWDEYHPSDKANEMIANEIIRKLGFL 117 P S LC DRSKYVFWDEYHPSD+ANE+IA E+I+K GF+ Sbjct: 309 PASKLCKDRSKYVFWDEYHPSDRANELIAKELIKKFGFI 347 >ref|XP_007155304.1| hypothetical protein PHAVU_003G189500g [Phaseolus vulgaris] gi|561028658|gb|ESW27298.1| hypothetical protein PHAVU_003G189500g [Phaseolus vulgaris] Length = 368 Score = 70.5 bits (171), Expect = 2e-10 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +1 Query: 1 PLSTLCSDRSKYVFWDEYHPSDKANEMIANEIIRKLGFL 117 P S+LC DRSKYVFWDEYHP+D ANE+IANE+I+K G L Sbjct: 309 PASSLCKDRSKYVFWDEYHPTDNANELIANELIKKFGLL 347 >ref|XP_004965047.1| PREDICTED: GDSL esterase/lipase At1g74460-like [Setaria italica] Length = 355 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +1 Query: 1 PLSTLCSDRSKYVFWDEYHPSDKANEMIANEIIRKL 108 PLSTLC DRSKYVFWDEYHP+DKANE+IA E +RKL Sbjct: 309 PLSTLCKDRSKYVFWDEYHPTDKANELIALETLRKL 344 >ref|XP_007209292.1| hypothetical protein PRUPE_ppa007718mg [Prunus persica] gi|462405027|gb|EMJ10491.1| hypothetical protein PRUPE_ppa007718mg [Prunus persica] Length = 358 Score = 68.9 bits (167), Expect = 7e-10 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +1 Query: 1 PLSTLCSDRSKYVFWDEYHPSDKANEMIANEIIRKLGF 114 P S LC DRSKYVFWDEYHPSD ANE+IA E+I+K GF Sbjct: 300 PASVLCKDRSKYVFWDEYHPSDGANELIARELIKKFGF 337