BLASTX nr result
ID: Cocculus22_contig00031674
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00031674 (316 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002309359.1| pentatricopeptide repeat-containing family p... 114 1e-23 emb|CBI36552.3| unnamed protein product [Vitis vinifera] 113 3e-23 ref|XP_002275298.1| PREDICTED: pentatricopeptide repeat-containi... 113 3e-23 gb|EXB42930.1| hypothetical protein L484_013952 [Morus notabilis] 112 5e-23 ref|XP_006656718.1| PREDICTED: pentatricopeptide repeat-containi... 112 7e-23 ref|XP_004964651.1| PREDICTED: pentatricopeptide repeat-containi... 112 7e-23 ref|XP_004288724.1| PREDICTED: pentatricopeptide repeat-containi... 112 7e-23 ref|NP_001057005.1| Os06g0185800 [Oryza sativa Japonica Group] g... 112 7e-23 gb|AFW85541.1| hypothetical protein ZEAMMB73_780855 [Zea mays] 112 7e-23 gb|EEC80145.1| hypothetical protein OsI_21946 [Oryza sativa Indi... 112 7e-23 ref|XP_007204599.1| hypothetical protein PRUPE_ppa002987mg [Prun... 111 9e-23 ref|XP_004507756.1| PREDICTED: pentatricopeptide repeat-containi... 110 2e-22 ref|XP_003560982.1| PREDICTED: pentatricopeptide repeat-containi... 109 3e-22 ref|XP_003550682.1| PREDICTED: pentatricopeptide repeat-containi... 109 3e-22 ref|XP_006474049.1| PREDICTED: pentatricopeptide repeat-containi... 108 6e-22 ref|NP_194799.1| pentatricopeptide repeat-containing protein [Ar... 108 8e-22 ref|XP_007154866.1| hypothetical protein PHAVU_003G154400g [Phas... 108 8e-22 ref|XP_006412675.1| hypothetical protein EUTSA_v10024455mg [Eutr... 108 8e-22 ref|XP_004163058.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 108 8e-22 ref|XP_004152852.1| PREDICTED: pentatricopeptide repeat-containi... 108 8e-22 >ref|XP_002309359.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222855335|gb|EEE92882.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 605 Score = 114 bits (285), Expect = 1e-23 Identities = 48/54 (88%), Positives = 52/54 (96%) Frame = +2 Query: 8 PGTEIRIIKNLRVCLDCHNWTKFISKITQTVIVVRDANRFHHFRDGVCSCGDYW 169 PG EIRIIKNLRVCLDCHNWTKF+SKIT+ VIVVRDANRFHHF+DG+CSCGDYW Sbjct: 552 PGAEIRIIKNLRVCLDCHNWTKFLSKITKRVIVVRDANRFHHFKDGLCSCGDYW 605 >emb|CBI36552.3| unnamed protein product [Vitis vinifera] Length = 726 Score = 113 bits (282), Expect = 3e-23 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = +2 Query: 2 SIPGTEIRIIKNLRVCLDCHNWTKFISKITQTVIVVRDANRFHHFRDGVCSCGDYW 169 S PGTEIRIIKNLRVCLDCHN TKFISKIT+ VIVVRDANRFHHF+DG+CSCGDYW Sbjct: 671 SEPGTEIRIIKNLRVCLDCHNATKFISKITERVIVVRDANRFHHFKDGICSCGDYW 726 >ref|XP_002275298.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700 [Vitis vinifera] Length = 781 Score = 113 bits (282), Expect = 3e-23 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = +2 Query: 2 SIPGTEIRIIKNLRVCLDCHNWTKFISKITQTVIVVRDANRFHHFRDGVCSCGDYW 169 S PGTEIRIIKNLRVCLDCHN TKFISKIT+ VIVVRDANRFHHF+DG+CSCGDYW Sbjct: 726 SEPGTEIRIIKNLRVCLDCHNATKFISKITERVIVVRDANRFHHFKDGICSCGDYW 781 >gb|EXB42930.1| hypothetical protein L484_013952 [Morus notabilis] Length = 781 Score = 112 bits (280), Expect = 5e-23 Identities = 48/54 (88%), Positives = 52/54 (96%) Frame = +2 Query: 8 PGTEIRIIKNLRVCLDCHNWTKFISKITQTVIVVRDANRFHHFRDGVCSCGDYW 169 PGTEIRI+KNLRVCLDCHN TKFISK+T+ VIVVRDANRFHHF+DGVCSCGDYW Sbjct: 728 PGTEIRIVKNLRVCLDCHNATKFISKVTERVIVVRDANRFHHFKDGVCSCGDYW 781 >ref|XP_006656718.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700-like [Oryza brachyantha] Length = 672 Score = 112 bits (279), Expect = 7e-23 Identities = 49/54 (90%), Positives = 52/54 (96%) Frame = +2 Query: 8 PGTEIRIIKNLRVCLDCHNWTKFISKITQTVIVVRDANRFHHFRDGVCSCGDYW 169 PGTEIRIIKNLRVCLDCHN TKFISK+TQ +IVVRDA+RFHHFRDGVCSCGDYW Sbjct: 619 PGTEIRIIKNLRVCLDCHNATKFISKVTQRLIVVRDASRFHHFRDGVCSCGDYW 672 >ref|XP_004964651.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700-like [Setaria italica] Length = 788 Score = 112 bits (279), Expect = 7e-23 Identities = 49/54 (90%), Positives = 52/54 (96%) Frame = +2 Query: 8 PGTEIRIIKNLRVCLDCHNWTKFISKITQTVIVVRDANRFHHFRDGVCSCGDYW 169 PGTEIRIIKNLRVCLDCHN TKFISK+TQ +IVVRDA+RFHHFRDGVCSCGDYW Sbjct: 735 PGTEIRIIKNLRVCLDCHNATKFISKVTQRLIVVRDASRFHHFRDGVCSCGDYW 788 >ref|XP_004288724.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700-like [Fragaria vesca subsp. vesca] Length = 790 Score = 112 bits (279), Expect = 7e-23 Identities = 50/54 (92%), Positives = 51/54 (94%) Frame = +2 Query: 8 PGTEIRIIKNLRVCLDCHNWTKFISKITQTVIVVRDANRFHHFRDGVCSCGDYW 169 PGTEIRIIKNLRVCLDCHN TKFIS ITQ VIVVRDANRFHHF+DGVCSCGDYW Sbjct: 737 PGTEIRIIKNLRVCLDCHNATKFISMITQRVIVVRDANRFHHFKDGVCSCGDYW 790 >ref|NP_001057005.1| Os06g0185800 [Oryza sativa Japonica Group] gi|55773756|dbj|BAD72439.1| pentatricopeptide (PPR) repeat-containing protein-like [Oryza sativa Japonica Group] gi|113595045|dbj|BAF18919.1| Os06g0185800 [Oryza sativa Japonica Group] gi|125596288|gb|EAZ36068.1| hypothetical protein OsJ_20378 [Oryza sativa Japonica Group] Length = 787 Score = 112 bits (279), Expect = 7e-23 Identities = 49/54 (90%), Positives = 52/54 (96%) Frame = +2 Query: 8 PGTEIRIIKNLRVCLDCHNWTKFISKITQTVIVVRDANRFHHFRDGVCSCGDYW 169 PGTEIRIIKNLRVCLDCHN TKFISK+TQ +IVVRDA+RFHHFRDGVCSCGDYW Sbjct: 734 PGTEIRIIKNLRVCLDCHNATKFISKVTQRLIVVRDASRFHHFRDGVCSCGDYW 787 >gb|AFW85541.1| hypothetical protein ZEAMMB73_780855 [Zea mays] Length = 787 Score = 112 bits (279), Expect = 7e-23 Identities = 49/54 (90%), Positives = 52/54 (96%) Frame = +2 Query: 8 PGTEIRIIKNLRVCLDCHNWTKFISKITQTVIVVRDANRFHHFRDGVCSCGDYW 169 PGTEIRIIKNLRVCLDCHN TKFISK+TQ +IVVRDA+RFHHFRDGVCSCGDYW Sbjct: 734 PGTEIRIIKNLRVCLDCHNATKFISKVTQRLIVVRDASRFHHFRDGVCSCGDYW 787 >gb|EEC80145.1| hypothetical protein OsI_21946 [Oryza sativa Indica Group] Length = 603 Score = 112 bits (279), Expect = 7e-23 Identities = 49/54 (90%), Positives = 52/54 (96%) Frame = +2 Query: 8 PGTEIRIIKNLRVCLDCHNWTKFISKITQTVIVVRDANRFHHFRDGVCSCGDYW 169 PGTEIRIIKNLRVCLDCHN TKFISK+TQ +IVVRDA+RFHHFRDGVCSCGDYW Sbjct: 550 PGTEIRIIKNLRVCLDCHNATKFISKVTQRLIVVRDASRFHHFRDGVCSCGDYW 603 >ref|XP_007204599.1| hypothetical protein PRUPE_ppa002987mg [Prunus persica] gi|462400130|gb|EMJ05798.1| hypothetical protein PRUPE_ppa002987mg [Prunus persica] Length = 614 Score = 111 bits (278), Expect = 9e-23 Identities = 49/54 (90%), Positives = 51/54 (94%) Frame = +2 Query: 8 PGTEIRIIKNLRVCLDCHNWTKFISKITQTVIVVRDANRFHHFRDGVCSCGDYW 169 PGTEIRI KNLRVCLDCHN TKFISKIT+ VIVVRDANRFHHF+DGVCSCGDYW Sbjct: 561 PGTEIRIFKNLRVCLDCHNATKFISKITERVIVVRDANRFHHFKDGVCSCGDYW 614 >ref|XP_004507756.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700-like [Cicer arietinum] Length = 783 Score = 110 bits (275), Expect = 2e-22 Identities = 48/54 (88%), Positives = 51/54 (94%) Frame = +2 Query: 8 PGTEIRIIKNLRVCLDCHNWTKFISKITQTVIVVRDANRFHHFRDGVCSCGDYW 169 PGTEIRIIKNLRVCLDCH TKFISKIT+ VIVVRDANRFHHF+DG+CSCGDYW Sbjct: 730 PGTEIRIIKNLRVCLDCHTATKFISKITERVIVVRDANRFHHFKDGICSCGDYW 783 >ref|XP_003560982.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700-like [Brachypodium distachyon] Length = 796 Score = 109 bits (273), Expect = 3e-22 Identities = 48/54 (88%), Positives = 51/54 (94%) Frame = +2 Query: 8 PGTEIRIIKNLRVCLDCHNWTKFISKITQTVIVVRDANRFHHFRDGVCSCGDYW 169 PGTEIRIIKNLRVCLDCHN TK ISK+TQ +IVVRDA+RFHHFRDGVCSCGDYW Sbjct: 743 PGTEIRIIKNLRVCLDCHNATKIISKVTQRLIVVRDASRFHHFRDGVCSCGDYW 796 >ref|XP_003550682.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700-like [Glycine max] Length = 778 Score = 109 bits (273), Expect = 3e-22 Identities = 48/54 (88%), Positives = 51/54 (94%) Frame = +2 Query: 8 PGTEIRIIKNLRVCLDCHNWTKFISKITQTVIVVRDANRFHHFRDGVCSCGDYW 169 PGTEIRIIKNLRVCLDCH TKFISKIT+ VIVVRDANRFHHF+DG+CSCGDYW Sbjct: 725 PGTEIRIIKNLRVCLDCHAATKFISKITERVIVVRDANRFHHFKDGICSCGDYW 778 >ref|XP_006474049.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700-like [Citrus sinensis] Length = 784 Score = 108 bits (271), Expect = 6e-22 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = +2 Query: 8 PGTEIRIIKNLRVCLDCHNWTKFISKITQTVIVVRDANRFHHFRDGVCSCGDYW 169 PGTEIRIIKNLRVCLDCH TKFISK+T VIVVRDANRFHHF+DGVCSCGDYW Sbjct: 731 PGTEIRIIKNLRVCLDCHTATKFISKVTGRVIVVRDANRFHHFKDGVCSCGDYW 784 >ref|NP_194799.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75208664|sp|Q9SUH6.1|PP341_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g30700; AltName: Full=Protein DYW9 gi|5725434|emb|CAB52443.1| putative protein [Arabidopsis thaliana] gi|7269971|emb|CAB79788.1| putative protein [Arabidopsis thaliana] gi|332660398|gb|AEE85798.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 792 Score = 108 bits (270), Expect = 8e-22 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = +2 Query: 8 PGTEIRIIKNLRVCLDCHNWTKFISKITQTVIVVRDANRFHHFRDGVCSCGDYW 169 PGTEIRIIKNLRVCLDCH TK ISKIT+ VIVVRDANRFHHF+DGVCSCGDYW Sbjct: 739 PGTEIRIIKNLRVCLDCHTVTKLISKITERVIVVRDANRFHHFKDGVCSCGDYW 792 >ref|XP_007154866.1| hypothetical protein PHAVU_003G154400g [Phaseolus vulgaris] gi|561028220|gb|ESW26860.1| hypothetical protein PHAVU_003G154400g [Phaseolus vulgaris] Length = 778 Score = 108 bits (270), Expect = 8e-22 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = +2 Query: 8 PGTEIRIIKNLRVCLDCHNWTKFISKITQTVIVVRDANRFHHFRDGVCSCGDYW 169 PGTEIRIIKNLRVCLDCH TKFISKIT+ VIVVRDANRFHHF+DG CSCGDYW Sbjct: 725 PGTEIRIIKNLRVCLDCHTATKFISKITERVIVVRDANRFHHFKDGSCSCGDYW 778 >ref|XP_006412675.1| hypothetical protein EUTSA_v10024455mg [Eutrema salsugineum] gi|557113845|gb|ESQ54128.1| hypothetical protein EUTSA_v10024455mg [Eutrema salsugineum] Length = 790 Score = 108 bits (270), Expect = 8e-22 Identities = 48/54 (88%), Positives = 50/54 (92%) Frame = +2 Query: 8 PGTEIRIIKNLRVCLDCHNWTKFISKITQTVIVVRDANRFHHFRDGVCSCGDYW 169 PGTEIRIIKNLRVCLDCH TK ISKIT+ VIVVRDANRFHHF+DGVCSCGDYW Sbjct: 737 PGTEIRIIKNLRVCLDCHTVTKLISKITERVIVVRDANRFHHFKDGVCSCGDYW 790 >ref|XP_004163058.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g30700-like [Cucumis sativus] Length = 788 Score = 108 bits (270), Expect = 8e-22 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = +2 Query: 8 PGTEIRIIKNLRVCLDCHNWTKFISKITQTVIVVRDANRFHHFRDGVCSCGDYW 169 PGTEIRIIKNLRVCLDCH TKFISKIT+ VIVVRDANRFHHF++G+CSCGDYW Sbjct: 735 PGTEIRIIKNLRVCLDCHTATKFISKITERVIVVRDANRFHHFKNGICSCGDYW 788 >ref|XP_004152852.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700-like [Cucumis sativus] Length = 788 Score = 108 bits (270), Expect = 8e-22 Identities = 47/54 (87%), Positives = 51/54 (94%) Frame = +2 Query: 8 PGTEIRIIKNLRVCLDCHNWTKFISKITQTVIVVRDANRFHHFRDGVCSCGDYW 169 PGTEIRIIKNLRVCLDCH TKFISKIT+ VIVVRDANRFHHF++G+CSCGDYW Sbjct: 735 PGTEIRIIKNLRVCLDCHTATKFISKITERVIVVRDANRFHHFKNGICSCGDYW 788