BLASTX nr result
ID: Cocculus22_contig00031510
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00031510 (313 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_173382.1| hypothetical protein NitaMp036 [Nicotiana tabac... 70 2e-10 >ref|YP_173382.1| hypothetical protein NitaMp036 [Nicotiana tabacum] gi|56806545|dbj|BAD83446.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 129 Score = 70.5 bits (171), Expect = 2e-10 Identities = 35/51 (68%), Positives = 40/51 (78%) Frame = -2 Query: 201 GRKGDSLFYWLTLVSGLGTAYT*LGHDVAR*RMDGTYNQTQPLQYLRGKRK 49 GR+ + YWLTL+SGLGTAYT +AR RMDGTYNQTQPLQYLR K+K Sbjct: 40 GREEKVIRYWLTLISGLGTAYTRWMKVLARLRMDGTYNQTQPLQYLRRKKK 90