BLASTX nr result
ID: Cocculus22_contig00031350
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00031350 (307 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006383417.1| hypothetical protein POPTR_0005s15300g, part... 57 3e-06 ref|XP_006383413.1| hypothetical protein POPTR_0005s15260g, part... 57 3e-06 ref|XP_006388000.1| hypothetical protein POPTR_0418s00220g [Popu... 56 5e-06 >ref|XP_006383417.1| hypothetical protein POPTR_0005s15300g, partial [Populus trichocarpa] gi|550339027|gb|ERP61214.1| hypothetical protein POPTR_0005s15300g, partial [Populus trichocarpa] Length = 262 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/41 (56%), Positives = 27/41 (65%) Frame = +1 Query: 175 SLSGYTDYRFLMCSNEFNCGDIKEIGYPFWGGERPY*CGNP 297 S S D R++ CSN +CGDIK +GYPFWG RP CG P Sbjct: 13 SASANDDERYVSCSNSLDCGDIKGVGYPFWGSNRPDYCGYP 53 >ref|XP_006383413.1| hypothetical protein POPTR_0005s15260g, partial [Populus trichocarpa] gi|550339023|gb|ERP61210.1| hypothetical protein POPTR_0005s15260g, partial [Populus trichocarpa] Length = 566 Score = 56.6 bits (135), Expect = 3e-06 Identities = 21/35 (60%), Positives = 26/35 (74%) Frame = +1 Query: 193 DYRFLMCSNEFNCGDIKEIGYPFWGGERPY*CGNP 297 D R++ CSN F+CGD+K +GYPFWG RP CG P Sbjct: 317 DERYVNCSNSFDCGDVKGVGYPFWGSNRPDYCGYP 351 >ref|XP_006388000.1| hypothetical protein POPTR_0418s00220g [Populus trichocarpa] gi|550309175|gb|ERP46914.1| hypothetical protein POPTR_0418s00220g [Populus trichocarpa] Length = 524 Score = 56.2 bits (134), Expect = 5e-06 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = +1 Query: 193 DYRFLMCSNEFNCGDIKEIGYPFWGGERPY*CGNP 297 D R++ CSN F+CGDIK +GYPFWG RP CG P Sbjct: 287 DERYVSCSNLFDCGDIKGVGYPFWGSNRPDFCGYP 321