BLASTX nr result
ID: Cocculus22_contig00031213
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00031213 (345 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_008999567.1| cytochrome c biogenesis FC (mitochondrion) [... 65 1e-08 dbj|BAD94978.1| cytochrome c biogenesis orf452 [Arabidopsis thal... 65 1e-08 emb|CBX33249.1| hypothetical protein [Beta vulgaris subsp. marit... 63 4e-08 ref|YP_004222388.1| hypothetical protein BevumaM_p155 [Beta vulg... 63 4e-08 gb|AGC78967.1| hypothetical protein (mitochondrion) [Vicia faba]... 62 8e-08 ref|XP_003588283.1| Cytochrome c biogenesis [Medicago truncatula... 59 5e-07 >ref|YP_008999567.1| cytochrome c biogenesis FC (mitochondrion) [Helianthus annuus] gi|571031405|gb|AHF21050.1| cytochrome c biogenesis FC (mitochondrion) [Helianthus annuus] Length = 294 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 344 RPVAHASYLFRAGGVNSDSIRVFNPAAEMLS 252 RPVAHASYLFRAGGVNSDSIRVFNPAAEMLS Sbjct: 264 RPVAHASYLFRAGGVNSDSIRVFNPAAEMLS 294 >dbj|BAD94978.1| cytochrome c biogenesis orf452 [Arabidopsis thaliana] Length = 298 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 344 RPVAHASYLFRAGGVNSDSIRVFNPAAEMLS 252 RPVAHASYLFRAGGVNSDSIRVFNPAAEMLS Sbjct: 268 RPVAHASYLFRAGGVNSDSIRVFNPAAEMLS 298 >emb|CBX33249.1| hypothetical protein [Beta vulgaris subsp. maritima] Length = 294 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -2 Query: 344 RPVAHASYLFRAGGVNSDSIRVFNPAAEMLS 252 RPVAHASYLFRAGGVNSDSIRVFNPAAE+LS Sbjct: 264 RPVAHASYLFRAGGVNSDSIRVFNPAAEVLS 294 >ref|YP_004222388.1| hypothetical protein BevumaM_p155 [Beta vulgaris subsp. maritima] gi|346683261|ref|YP_004842194.1| hypothetical protein BemaM_p150 [Beta macrocarpa] gi|317905620|emb|CBX33222.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439903|emb|CBX33317.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500179|emb|CBX24998.1| hypothetical protein [Beta macrocarpa] gi|384939164|emb|CBL52011.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 294 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -2 Query: 344 RPVAHASYLFRAGGVNSDSIRVFNPAAEMLS 252 RPVAHASYLFRAGGVNSDSIRVFNPAAE+LS Sbjct: 264 RPVAHASYLFRAGGVNSDSIRVFNPAAEVLS 294 >gb|AGC78967.1| hypothetical protein (mitochondrion) [Vicia faba] gi|442803259|gb|AGC78994.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 298 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 344 RPVAHASYLFRAGGVNSDSIRVFNPAAEMLS 252 RPVAHASYLF AGGVNSDSIRVFNPAAEMLS Sbjct: 268 RPVAHASYLFGAGGVNSDSIRVFNPAAEMLS 298 >ref|XP_003588283.1| Cytochrome c biogenesis [Medicago truncatula] gi|355477331|gb|AES58534.1| Cytochrome c biogenesis [Medicago truncatula] Length = 860 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 344 RPVAHASYLFRAGGVNSDSIRVFNPAAEMLS 252 RPVAHASYLF AGGVNSDSIRVFNPAAE+L+ Sbjct: 268 RPVAHASYLFGAGGVNSDSIRVFNPAAEILA 298