BLASTX nr result
ID: Cocculus22_contig00031191
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00031191 (486 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268999.1| PREDICTED: pentatricopeptide repeat-containi... 78 1e-12 emb|CAN80769.1| hypothetical protein VITISV_013866 [Vitis vinifera] 76 6e-12 ref|XP_004300036.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 ref|XP_003624026.1| Pentatricopeptide repeat-containing protein ... 64 3e-08 ref|XP_004485903.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 ref|XP_006575401.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 ref|XP_006358473.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 ref|XP_004231316.1| PREDICTED: pentatricopeptide repeat-containi... 55 8e-06 >ref|XP_002268999.1| PREDICTED: pentatricopeptide repeat-containing protein At1g14470-like [Vitis vinifera] Length = 729 Score = 77.8 bits (190), Expect = 1e-12 Identities = 32/59 (54%), Positives = 42/59 (71%) Frame = +3 Query: 303 NNVRNLNHLRELHAQVTHHLLHQDNYWISILIRQCTIIRAPQHYVRLLFNSARHHNIMV 479 + V N NHLR+LHAQ+ H+ LH NYW+++LI CT +RAP HY LLFNS + N+ V Sbjct: 9 SRVGNFNHLRQLHAQIIHNSLHHHNYWVALLINHCTRLRAPPHYTHLLFNSTLNPNVFV 67 >emb|CAN80769.1| hypothetical protein VITISV_013866 [Vitis vinifera] Length = 761 Score = 75.9 bits (185), Expect = 6e-12 Identities = 31/59 (52%), Positives = 42/59 (71%) Frame = +3 Query: 303 NNVRNLNHLRELHAQVTHHLLHQDNYWISILIRQCTIIRAPQHYVRLLFNSARHHNIMV 479 + V N +HLR+LHAQ+ H+ LH NYW+++LI CT +RAP HY LLFNS + N+ V Sbjct: 9 SRVGNFSHLRQLHAQIIHNSLHHHNYWVALLINHCTRLRAPPHYTHLLFNSTLNPNVFV 67 >ref|XP_004300036.1| PREDICTED: pentatricopeptide repeat-containing protein At1g14470-like [Fragaria vesca subsp. vesca] Length = 764 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/59 (45%), Positives = 39/59 (66%) Frame = +3 Query: 303 NNVRNLNHLRELHAQVTHHLLHQDNYWISILIRQCTIIRAPQHYVRLLFNSARHHNIMV 479 + + N++ LR+LHA + +H N+W+S LI QCT +RAP Y RL+F+S H NI V Sbjct: 11 SKISNVSQLRQLHAHLFQKSVHHQNHWVSFLINQCTRLRAPPPYTRLIFDSTPHPNIHV 69 >ref|XP_003624026.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|124360495|gb|ABN08505.1| Tetratricopeptide-like helical [Medicago truncatula] gi|355499041|gb|AES80244.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 646 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/59 (42%), Positives = 40/59 (67%) Frame = +3 Query: 303 NNVRNLNHLRELHAQVTHHLLHQDNYWISILIRQCTIIRAPQHYVRLLFNSARHHNIMV 479 + + NL+ LR+LHAQ+ HH LH N+W+ +L+ QCT + AP Y +F++A H ++ V Sbjct: 11 SKITNLHRLRQLHAQLVHHSLHHQNHWVVLLLTQCTRLLAPSSYTCHIFHAATHPDVRV 69 >ref|XP_004485903.1| PREDICTED: pentatricopeptide repeat-containing protein At1g14470-like [Cicer arietinum] Length = 613 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/59 (44%), Positives = 37/59 (62%) Frame = +3 Query: 303 NNVRNLNHLRELHAQVTHHLLHQDNYWISILIRQCTIIRAPQHYVRLLFNSARHHNIMV 479 N + NL+ LR+LHAQ+ HH LH N+W+S L+ QCT + AP Y +F+ H + V Sbjct: 11 NKITNLHCLRQLHAQLLHHSLHHQNHWVSFLLTQCTRLLAPSTYTSHIFHLTTHPDARV 69 >ref|XP_006575401.1| PREDICTED: pentatricopeptide repeat-containing protein At1g14470-like [Glycine max] Length = 640 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/59 (40%), Positives = 40/59 (67%) Frame = +3 Query: 303 NNVRNLNHLRELHAQVTHHLLHQDNYWISILIRQCTIIRAPQHYVRLLFNSARHHNIMV 479 + + NL+HLR+LHAQ+ H H N+W+++L+ QCT + AP +Y +F +A + N+ V Sbjct: 11 SKITNLHHLRQLHAQLVLHSQHHHNHWVALLLTQCTHLLAPSNYTSHIFRAATYPNVHV 69 >ref|XP_006358473.1| PREDICTED: pentatricopeptide repeat-containing protein At1g14470-like [Solanum tuberosum] Length = 758 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/68 (42%), Positives = 41/68 (60%) Frame = +3 Query: 276 MSHLAAFACNNVRNLNHLRELHAQVTHHLLHQDNYWISILIRQCTIIRAPQHYVRLLFNS 455 MSHL A + LNHL++LHAQ+ L DNYW++ LI+ CT + AP YV +F+S Sbjct: 1 MSHLHTAALKATK-LNHLKQLHAQLFQRSLCSDNYWVAQLIKLCTRLHAPPTYVSRVFDS 59 Query: 456 ARHHNIMV 479 N+ + Sbjct: 60 VHQPNVFI 67 >ref|XP_004231316.1| PREDICTED: pentatricopeptide repeat-containing protein At1g14470-like [Solanum lycopersicum] Length = 758 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/68 (41%), Positives = 39/68 (57%) Frame = +3 Query: 276 MSHLAAFACNNVRNLNHLRELHAQVTHHLLHQDNYWISILIRQCTIIRAPQHYVRLLFNS 455 MSHL A + L HL++ HAQ+ L DNYW++ LI+ CT + AP YV +F+S Sbjct: 1 MSHLHTAALKATK-LIHLKQFHAQLFQRSLCSDNYWVAQLIKLCTRLHAPSTYVSRVFDS 59 Query: 456 ARHHNIMV 479 N+ V Sbjct: 60 VHQPNVFV 67