BLASTX nr result
ID: Cocculus22_contig00030566
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00030566 (430 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004251337.1| PREDICTED: zinc finger CCCH domain-containin... 52 6e-08 gb|EMT32909.1| Zinc finger CCCH domain-containing protein 44 [Ae... 51 3e-06 ref|XP_006582460.1| PREDICTED: zinc finger CCCH domain-containin... 57 3e-06 ref|XP_003576761.1| PREDICTED: uncharacterized protein LOC100835... 51 4e-06 >ref|XP_004251337.1| PREDICTED: zinc finger CCCH domain-containing protein 19-like [Solanum lycopersicum] Length = 1397 Score = 51.6 bits (122), Expect(2) = 6e-08 Identities = 23/43 (53%), Positives = 30/43 (69%) Frame = +3 Query: 33 GTFF*LQLHKWSTTSHFPANLMIWKTKENQEVSITLVDALNGK 161 G F +QL KWS T +FPA+L IW++ + QE SI L DAL G+ Sbjct: 871 GPFSLVQLRKWSNTGYFPADLKIWRSSDKQEESILLTDALAGR 913 Score = 30.8 bits (68), Expect(2) = 6e-08 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +1 Query: 1 WHYKDHTGKTQGPFS 45 WHYKD + K QGPFS Sbjct: 860 WHYKDPSSKIQGPFS 874 >gb|EMT32909.1| Zinc finger CCCH domain-containing protein 44 [Aegilops tauschii] Length = 1804 Score = 51.2 bits (121), Expect(2) = 3e-06 Identities = 24/43 (55%), Positives = 30/43 (69%) Frame = +3 Query: 33 GTFF*LQLHKWSTTSHFPANLMIWKTKENQEVSITLVDALNGK 161 G F +QL KW+++ +FP NL IWK+ E QE SI L DAL GK Sbjct: 1249 GPFSIVQLRKWNSSGYFPHNLKIWKSNEKQEDSILLPDALAGK 1291 Score = 25.4 bits (54), Expect(2) = 3e-06 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 Query: 1 WHYKDHTGKTQGPFS 45 W Y D + K QGPFS Sbjct: 1238 WQYMDPSNKIQGPFS 1252 >ref|XP_006582460.1| PREDICTED: zinc finger CCCH domain-containing protein 19-like [Glycine max] Length = 1730 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/53 (50%), Positives = 34/53 (64%) Frame = +3 Query: 9 QRPYWENSGTFF*LQLHKWSTTSHFPANLMIWKTKENQEVSITLVDALNGKLA 167 Q P + G F +QLHKWS T +FPA+L IW+T E Q+ SI L DAL G + Sbjct: 1182 QDPSGKVQGPFSMVQLHKWSNTGYFPADLRIWRTTEKQDDSILLTDALAGNFS 1234 >ref|XP_003576761.1| PREDICTED: uncharacterized protein LOC100835763 [Brachypodium distachyon] Length = 1800 Score = 50.8 bits (120), Expect(2) = 4e-06 Identities = 23/43 (53%), Positives = 29/43 (67%) Frame = +3 Query: 33 GTFF*LQLHKWSTTSHFPANLMIWKTKENQEVSITLVDALNGK 161 G F +QL KW+ + +FP NL IWK+ E Q+ SI L DAL GK Sbjct: 1224 GPFSIVQLRKWNNSGYFPPNLKIWKSNEKQDDSILLADALAGK 1266 Score = 25.4 bits (54), Expect(2) = 4e-06 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 Query: 1 WHYKDHTGKTQGPFS 45 W Y D + K QGPFS Sbjct: 1213 WQYMDPSNKIQGPFS 1227