BLASTX nr result
ID: Cocculus22_contig00030483
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00030483 (329 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007207617.1| hypothetical protein PRUPE_ppa019748mg, part... 48 1e-06 ref|XP_007224079.1| hypothetical protein PRUPE_ppa015473mg, part... 47 6e-06 >ref|XP_007207617.1| hypothetical protein PRUPE_ppa019748mg, partial [Prunus persica] gi|462403259|gb|EMJ08816.1| hypothetical protein PRUPE_ppa019748mg, partial [Prunus persica] Length = 1170 Score = 47.8 bits (112), Expect(2) = 1e-06 Identities = 24/48 (50%), Positives = 31/48 (64%) Frame = +2 Query: 173 GCAVGA*PMK*LGMQLGGNPLHKTF*ERVLIKIANRL*GWKKSSLSSD 316 GC VGA PM LG+ LGGNP F + V+ K+ NRL WK++ LS + Sbjct: 703 GCEVGAWPMSYLGLPLGGNPRAIKFWDPVVEKVENRLQKWKRACLSKE 750 Score = 30.0 bits (66), Expect(2) = 1e-06 Identities = 12/38 (31%), Positives = 23/38 (60%) Frame = +3 Query: 24 EERDENVMGAIDILKAFCWIFNFNMNLAKSQLLEINME 137 E++DE + IL+ FC++ +N +K L+ IN++ Sbjct: 654 EDKDEYWNNLLQILELFCFVSGMEINKSKCSLVGINLD 691 >ref|XP_007224079.1| hypothetical protein PRUPE_ppa015473mg, partial [Prunus persica] gi|462421015|gb|EMJ25278.1| hypothetical protein PRUPE_ppa015473mg, partial [Prunus persica] Length = 1419 Score = 47.0 bits (110), Expect(2) = 6e-06 Identities = 24/46 (52%), Positives = 30/46 (65%) Frame = +2 Query: 173 GCAVGA*PMK*LGMQLGGNPLHKTF*ERVLIKIANRL*GWKKSSLS 310 GC VGA PM LG+ LGGNP F + V+ K+ NRL WK++ LS Sbjct: 997 GCEVGAWPMSYLGLPLGGNPRAIKFWDPVVEKVENRLQKWKRACLS 1042 Score = 28.5 bits (62), Expect(2) = 6e-06 Identities = 11/38 (28%), Positives = 23/38 (60%) Frame = +3 Query: 24 EERDENVMGAIDILKAFCWIFNFNMNLAKSQLLEINME 137 E+++E + IL+ FC++ +N +K L+ IN++ Sbjct: 948 EDKEEYWNNLLQILELFCFVSGMKINKSKCSLVGINLD 985