BLASTX nr result
ID: Cocculus22_contig00030424
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00030424 (321 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004503077.1| PREDICTED: helicase SEN1-like [Cicer arietinum] 58 1e-06 >ref|XP_004503077.1| PREDICTED: helicase SEN1-like [Cicer arietinum] Length = 946 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/58 (50%), Positives = 37/58 (63%) Frame = +2 Query: 41 VVMKDKIRASTYITQQMRYNLYAVLLMNLTTEIQIWEALKQKTEGESLNIIRNVLDAG 214 +VM K+ T+ LYAV LMNLTT ++IW+AL + EGE LNII+NVL G Sbjct: 168 LVMSSKLMIEFDFTKTNNQKLYAVNLMNLTTNVRIWKALNSQLEGEHLNIIKNVLQPG 225