BLASTX nr result
ID: Cocculus22_contig00029951
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00029951 (391 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC10222.1| hypothetical protein L484_004400 [Morus notabilis] 70 2e-10 ref|YP_173382.1| hypothetical protein NitaMp036 [Nicotiana tabac... 57 3e-06 >gb|EXC10222.1| hypothetical protein L484_004400 [Morus notabilis] Length = 133 Score = 70.5 bits (171), Expect = 2e-10 Identities = 34/48 (70%), Positives = 38/48 (79%), Gaps = 2/48 (4%) Frame = -2 Query: 210 PFKDAKGL--AYPHIKLTLFQTLPVDATAAITLAAGGEWLSDTLDVLF 73 P KD KG+ +YPH KLT+F LPVDA AITLAAGGEWLS+TLDV F Sbjct: 52 PLKDGKGVDTSYPHRKLTIFHALPVDARTAITLAAGGEWLSETLDVFF 99 >ref|YP_173382.1| hypothetical protein NitaMp036 [Nicotiana tabacum] gi|56806545|dbj|BAD83446.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 129 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/35 (80%), Positives = 29/35 (82%), Gaps = 2/35 (5%) Frame = -3 Query: 200 MQKVL--PIHI*S*PSSKHYRWMLQPLSLWLQEGN 102 MQKVL PIHI PSS HYRWMLQPLSLWLQ+GN Sbjct: 1 MQKVLIRPIHIEILPSSTHYRWMLQPLSLWLQDGN 35