BLASTX nr result
ID: Cocculus22_contig00029890
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00029890 (289 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB32136.1| hypothetical protein L484_004150 [Morus notabilis] 57 3e-06 >gb|EXB32136.1| hypothetical protein L484_004150 [Morus notabilis] Length = 201 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/49 (53%), Positives = 32/49 (65%) Frame = +2 Query: 143 IQCINEWIGVDGLPLDKWTPENFIEIGNGCGGLLEIAKDTETFSFLRFA 289 I+ N WIG++GLPL+ W F IG CGGL+E+AKDT SFL A Sbjct: 126 IEARNSWIGIEGLPLNLWNAHAFKIIGEACGGLIEVAKDTLGCSFLVLA 174