BLASTX nr result
ID: Cocculus22_contig00029565
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00029565 (450 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004299303.1| PREDICTED: uncharacterized mitochondrial car... 107 2e-21 ref|XP_006844804.1| hypothetical protein AMTR_s00058p00026290 [A... 104 1e-20 ref|XP_002318588.1| mitochondrial substrate carrier family prote... 102 7e-20 ref|XP_006477668.1| PREDICTED: mitochondrial substrate carrier f... 101 1e-19 ref|XP_006477667.1| PREDICTED: mitochondrial substrate carrier f... 101 1e-19 ref|XP_006477666.1| PREDICTED: mitochondrial substrate carrier f... 101 1e-19 ref|XP_006477665.1| PREDICTED: mitochondrial substrate carrier f... 101 1e-19 ref|XP_007037566.1| Mitochondrial substrate carrier family prote... 100 2e-19 ref|XP_006440749.1| hypothetical protein CICLE_v10020739mg [Citr... 100 4e-19 ref|XP_002887533.1| hypothetical protein ARALYDRAFT_339621 [Arab... 98 1e-18 emb|CBI15123.3| unnamed protein product [Vitis vinifera] 98 1e-18 ref|XP_002280848.1| PREDICTED: mitochondrial substrate carrier f... 98 1e-18 emb|CAN77961.1| hypothetical protein VITISV_022947 [Vitis vinifera] 98 1e-18 ref|XP_007209309.1| hypothetical protein PRUPE_ppa007881mg [Prun... 97 2e-18 ref|XP_006390446.1| hypothetical protein EUTSA_v10018752mg [Eutr... 97 3e-18 ref|XP_006302425.1| hypothetical protein CARUB_v10020507mg [Caps... 97 3e-18 ref|XP_004138196.1| PREDICTED: uncharacterized mitochondrial car... 96 5e-18 gb|AAG52407.1|AC020579_9 putative mitochondrial carrier protein;... 96 7e-18 ref|NP_177564.2| mitochondrial substrate carrier family protein ... 96 7e-18 gb|ACL52927.1| unknown [Zea mays] gi|414865510|tpg|DAA44067.1| T... 95 9e-18 >ref|XP_004299303.1| PREDICTED: uncharacterized mitochondrial carrier C1442.03-like [Fragaria vesca subsp. vesca] Length = 365 Score = 107 bits (267), Expect = 2e-21 Identities = 46/64 (71%), Positives = 53/64 (82%) Frame = +2 Query: 2 VYVPCEVMKQRMQVQGTRENWDSRVMKENVCKKSGTKMYGYYAGMFQAGCSIWKEQGPRG 181 VYVPCEVMKQRMQVQGT+ +W S ++K+N+ K G MY YY GMFQAGCSIWKEQGPRG Sbjct: 145 VYVPCEVMKQRMQVQGTKASWSSAMLKDNISMKPGIHMYDYYTGMFQAGCSIWKEQGPRG 204 Query: 182 LFIG 193 L+ G Sbjct: 205 LYAG 208 >ref|XP_006844804.1| hypothetical protein AMTR_s00058p00026290 [Amborella trichopoda] gi|548847295|gb|ERN06479.1| hypothetical protein AMTR_s00058p00026290 [Amborella trichopoda] Length = 362 Score = 104 bits (259), Expect = 1e-20 Identities = 46/64 (71%), Positives = 55/64 (85%) Frame = +2 Query: 2 VYVPCEVMKQRMQVQGTRENWDSRVMKENVCKKSGTKMYGYYAGMFQAGCSIWKEQGPRG 181 VYVPCEVMKQRMQVQGTR++W + + KEN+C KSG +MYGYY+GMFQA CSI K+QG RG Sbjct: 142 VYVPCEVMKQRMQVQGTRKSWSAVLAKENICHKSGEQMYGYYSGMFQAACSIRKQQGLRG 201 Query: 182 LFIG 193 L+ G Sbjct: 202 LYAG 205 >ref|XP_002318588.1| mitochondrial substrate carrier family protein [Populus trichocarpa] gi|222859261|gb|EEE96808.1| mitochondrial substrate carrier family protein [Populus trichocarpa] Length = 316 Score = 102 bits (253), Expect = 7e-20 Identities = 44/64 (68%), Positives = 56/64 (87%) Frame = +2 Query: 2 VYVPCEVMKQRMQVQGTRENWDSRVMKENVCKKSGTKMYGYYAGMFQAGCSIWKEQGPRG 181 VYVPCEVMKQRMQVQG+R +W+S ++K+++ +KSG ++YGYY GMFQAG SI KEQGPRG Sbjct: 123 VYVPCEVMKQRMQVQGSRTSWNSSIIKDSISRKSGEQIYGYYTGMFQAGSSILKEQGPRG 182 Query: 182 LFIG 193 L+ G Sbjct: 183 LYAG 186 >ref|XP_006477668.1| PREDICTED: mitochondrial substrate carrier family protein E-like isoform X4 [Citrus sinensis] Length = 319 Score = 101 bits (251), Expect = 1e-19 Identities = 44/64 (68%), Positives = 54/64 (84%) Frame = +2 Query: 2 VYVPCEVMKQRMQVQGTRENWDSRVMKENVCKKSGTKMYGYYAGMFQAGCSIWKEQGPRG 181 VYVPCEVMKQRMQVQGT ++W S +MK+N+C KS +MYGYY G++QAG SIW+EQG RG Sbjct: 99 VYVPCEVMKQRMQVQGTIKSWGSILMKDNICVKSNLQMYGYYTGIYQAGSSIWREQGLRG 158 Query: 182 LFIG 193 L+ G Sbjct: 159 LYAG 162 >ref|XP_006477667.1| PREDICTED: mitochondrial substrate carrier family protein E-like isoform X3 [Citrus sinensis] Length = 320 Score = 101 bits (251), Expect = 1e-19 Identities = 44/64 (68%), Positives = 54/64 (84%) Frame = +2 Query: 2 VYVPCEVMKQRMQVQGTRENWDSRVMKENVCKKSGTKMYGYYAGMFQAGCSIWKEQGPRG 181 VYVPCEVMKQRMQVQGT ++W S +MK+N+C KS +MYGYY G++QAG SIW+EQG RG Sbjct: 144 VYVPCEVMKQRMQVQGTIKSWGSILMKDNICVKSNLQMYGYYTGIYQAGSSIWREQGLRG 203 Query: 182 LFIG 193 L+ G Sbjct: 204 LYAG 207 >ref|XP_006477666.1| PREDICTED: mitochondrial substrate carrier family protein E-like isoform X2 [Citrus sinensis] Length = 324 Score = 101 bits (251), Expect = 1e-19 Identities = 44/64 (68%), Positives = 54/64 (84%) Frame = +2 Query: 2 VYVPCEVMKQRMQVQGTRENWDSRVMKENVCKKSGTKMYGYYAGMFQAGCSIWKEQGPRG 181 VYVPCEVMKQRMQVQGT ++W S +MK+N+C KS +MYGYY G++QAG SIW+EQG RG Sbjct: 144 VYVPCEVMKQRMQVQGTIKSWGSILMKDNICVKSNLQMYGYYTGIYQAGSSIWREQGLRG 203 Query: 182 LFIG 193 L+ G Sbjct: 204 LYAG 207 >ref|XP_006477665.1| PREDICTED: mitochondrial substrate carrier family protein E-like isoform X1 [Citrus sinensis] Length = 364 Score = 101 bits (251), Expect = 1e-19 Identities = 44/64 (68%), Positives = 54/64 (84%) Frame = +2 Query: 2 VYVPCEVMKQRMQVQGTRENWDSRVMKENVCKKSGTKMYGYYAGMFQAGCSIWKEQGPRG 181 VYVPCEVMKQRMQVQGT ++W S +MK+N+C KS +MYGYY G++QAG SIW+EQG RG Sbjct: 144 VYVPCEVMKQRMQVQGTIKSWGSILMKDNICVKSNLQMYGYYTGIYQAGSSIWREQGLRG 203 Query: 182 LFIG 193 L+ G Sbjct: 204 LYAG 207 >ref|XP_007037566.1| Mitochondrial substrate carrier family protein E [Theobroma cacao] gi|508774811|gb|EOY22067.1| Mitochondrial substrate carrier family protein E [Theobroma cacao] Length = 384 Score = 100 bits (249), Expect = 2e-19 Identities = 44/64 (68%), Positives = 55/64 (85%) Frame = +2 Query: 2 VYVPCEVMKQRMQVQGTRENWDSRVMKENVCKKSGTKMYGYYAGMFQAGCSIWKEQGPRG 181 VYVPCEVMKQRMQVQG+R +W+S +MK+++ KSG +MYGYY GMFQAG SIWK+QG +G Sbjct: 166 VYVPCEVMKQRMQVQGSRTSWNSAIMKDSMQMKSGAQMYGYYTGMFQAGRSIWKKQGLKG 225 Query: 182 LFIG 193 L+ G Sbjct: 226 LYAG 229 >ref|XP_006440749.1| hypothetical protein CICLE_v10020739mg [Citrus clementina] gi|557543011|gb|ESR53989.1| hypothetical protein CICLE_v10020739mg [Citrus clementina] Length = 364 Score = 99.8 bits (247), Expect = 4e-19 Identities = 43/64 (67%), Positives = 54/64 (84%) Frame = +2 Query: 2 VYVPCEVMKQRMQVQGTRENWDSRVMKENVCKKSGTKMYGYYAGMFQAGCSIWKEQGPRG 181 VYVPCEVMKQRMQVQGT ++W S +MK+N+C KS ++YGYY G++QAG SIW+EQG RG Sbjct: 144 VYVPCEVMKQRMQVQGTIKSWGSILMKDNICVKSNLQIYGYYTGIYQAGSSIWREQGLRG 203 Query: 182 LFIG 193 L+ G Sbjct: 204 LYAG 207 >ref|XP_002887533.1| hypothetical protein ARALYDRAFT_339621 [Arabidopsis lyrata subsp. lyrata] gi|297333374|gb|EFH63792.1| hypothetical protein ARALYDRAFT_339621 [Arabidopsis lyrata subsp. lyrata] Length = 364 Score = 98.2 bits (243), Expect = 1e-18 Identities = 42/64 (65%), Positives = 51/64 (79%) Frame = +2 Query: 2 VYVPCEVMKQRMQVQGTRENWDSRVMKENVCKKSGTKMYGYYAGMFQAGCSIWKEQGPRG 181 VYVPCEV+KQRMQ+QGT +W S +++ +V K MYGYY GMFQAGCSIWKEQGP+G Sbjct: 147 VYVPCEVIKQRMQIQGTSSSWSSFILRNSVPVKPRGDMYGYYTGMFQAGCSIWKEQGPKG 206 Query: 182 LFIG 193 L+ G Sbjct: 207 LYAG 210 >emb|CBI15123.3| unnamed protein product [Vitis vinifera] Length = 327 Score = 97.8 bits (242), Expect = 1e-18 Identities = 43/64 (67%), Positives = 50/64 (78%) Frame = +2 Query: 2 VYVPCEVMKQRMQVQGTRENWDSRVMKENVCKKSGTKMYGYYAGMFQAGCSIWKEQGPRG 181 VYVPCEVMKQRMQVQGT+ W S ++ + G +MYGYYAGMFQAGCSIWKEQG +G Sbjct: 107 VYVPCEVMKQRMQVQGTKTTWSSVIINGTARTRPGPQMYGYYAGMFQAGCSIWKEQGLKG 166 Query: 182 LFIG 193 L+ G Sbjct: 167 LYAG 170 >ref|XP_002280848.1| PREDICTED: mitochondrial substrate carrier family protein X-like [Vitis vinifera] Length = 352 Score = 97.8 bits (242), Expect = 1e-18 Identities = 43/64 (67%), Positives = 50/64 (78%) Frame = +2 Query: 2 VYVPCEVMKQRMQVQGTRENWDSRVMKENVCKKSGTKMYGYYAGMFQAGCSIWKEQGPRG 181 VYVPCEVMKQRMQVQGT+ W S ++ + G +MYGYYAGMFQAGCSIWKEQG +G Sbjct: 132 VYVPCEVMKQRMQVQGTKTTWSSVIINGTARTRPGPQMYGYYAGMFQAGCSIWKEQGLKG 191 Query: 182 LFIG 193 L+ G Sbjct: 192 LYAG 195 >emb|CAN77961.1| hypothetical protein VITISV_022947 [Vitis vinifera] Length = 376 Score = 97.8 bits (242), Expect = 1e-18 Identities = 43/64 (67%), Positives = 50/64 (78%) Frame = +2 Query: 2 VYVPCEVMKQRMQVQGTRENWDSRVMKENVCKKSGTKMYGYYAGMFQAGCSIWKEQGPRG 181 VYVPCEVMKQRMQVQGT+ W S ++ + G +MYGYYAGMFQAGCSIWKEQG +G Sbjct: 166 VYVPCEVMKQRMQVQGTKTTWSSVIINGTARTRPGPQMYGYYAGMFQAGCSIWKEQGLKG 225 Query: 182 LFIG 193 L+ G Sbjct: 226 LYAG 229 >ref|XP_007209309.1| hypothetical protein PRUPE_ppa007881mg [Prunus persica] gi|462405044|gb|EMJ10508.1| hypothetical protein PRUPE_ppa007881mg [Prunus persica] Length = 353 Score = 97.4 bits (241), Expect = 2e-18 Identities = 44/64 (68%), Positives = 51/64 (79%) Frame = +2 Query: 2 VYVPCEVMKQRMQVQGTRENWDSRVMKENVCKKSGTKMYGYYAGMFQAGCSIWKEQGPRG 181 VYVPCEVMKQRMQVQGT +W S +MK+N+ K +MYGYY GMFQAGCSI KEQG +G Sbjct: 133 VYVPCEVMKQRMQVQGTLTSWSSVMMKDNISMKPSLQMYGYYTGMFQAGCSILKEQGLKG 192 Query: 182 LFIG 193 L+ G Sbjct: 193 LYAG 196 >ref|XP_006390446.1| hypothetical protein EUTSA_v10018752mg [Eutrema salsugineum] gi|557086880|gb|ESQ27732.1| hypothetical protein EUTSA_v10018752mg [Eutrema salsugineum] Length = 363 Score = 96.7 bits (239), Expect = 3e-18 Identities = 41/64 (64%), Positives = 50/64 (78%) Frame = +2 Query: 2 VYVPCEVMKQRMQVQGTRENWDSRVMKENVCKKSGTKMYGYYAGMFQAGCSIWKEQGPRG 181 VYVPCEV+KQRMQ+QGT +W S + + ++ K MYGYY GMFQAGCSIWKEQGP+G Sbjct: 144 VYVPCEVIKQRMQIQGTSSSWSSFISRNSIPVKPRGDMYGYYTGMFQAGCSIWKEQGPKG 203 Query: 182 LFIG 193 L+ G Sbjct: 204 LYAG 207 >ref|XP_006302425.1| hypothetical protein CARUB_v10020507mg [Capsella rubella] gi|482571135|gb|EOA35323.1| hypothetical protein CARUB_v10020507mg [Capsella rubella] Length = 367 Score = 96.7 bits (239), Expect = 3e-18 Identities = 41/64 (64%), Positives = 50/64 (78%) Frame = +2 Query: 2 VYVPCEVMKQRMQVQGTRENWDSRVMKENVCKKSGTKMYGYYAGMFQAGCSIWKEQGPRG 181 +YVPCEV+KQRMQ+QGT +W S + + +V K MYGYY GMFQAGCSIWKEQGP+G Sbjct: 147 IYVPCEVIKQRMQIQGTSSSWSSFISRNSVPVKPRGDMYGYYTGMFQAGCSIWKEQGPKG 206 Query: 182 LFIG 193 L+ G Sbjct: 207 LYAG 210 >ref|XP_004138196.1| PREDICTED: uncharacterized mitochondrial carrier YMR166C-like [Cucumis sativus] gi|449524978|ref|XP_004169498.1| PREDICTED: uncharacterized mitochondrial carrier YMR166C-like [Cucumis sativus] Length = 361 Score = 95.9 bits (237), Expect = 5e-18 Identities = 45/64 (70%), Positives = 50/64 (78%) Frame = +2 Query: 2 VYVPCEVMKQRMQVQGTRENWDSRVMKENVCKKSGTKMYGYYAGMFQAGCSIWKEQGPRG 181 VYVPCEVMKQRMQVQGTR +W S MK N+ G +MYGYY+GMFQAG SI KEQG RG Sbjct: 139 VYVPCEVMKQRMQVQGTRSSWSSLPMKNNISMNHGGQMYGYYSGMFQAGRSILKEQGLRG 198 Query: 182 LFIG 193 L+ G Sbjct: 199 LYAG 202 >gb|AAG52407.1|AC020579_9 putative mitochondrial carrier protein; 35518-32968 [Arabidopsis thaliana] Length = 367 Score = 95.5 bits (236), Expect = 7e-18 Identities = 40/64 (62%), Positives = 50/64 (78%) Frame = +2 Query: 2 VYVPCEVMKQRMQVQGTRENWDSRVMKENVCKKSGTKMYGYYAGMFQAGCSIWKEQGPRG 181 +YVPCEV+KQRMQ+QGT +W S + + +V + MYGYY GMFQAGCSIWKEQGP+G Sbjct: 147 IYVPCEVIKQRMQIQGTSSSWSSYISRNSVPVQPRGDMYGYYTGMFQAGCSIWKEQGPKG 206 Query: 182 LFIG 193 L+ G Sbjct: 207 LYAG 210 >ref|NP_177564.2| mitochondrial substrate carrier family protein [Arabidopsis thaliana] gi|26450340|dbj|BAC42286.1| putative mitochondrial carrier protein [Arabidopsis thaliana] gi|28827414|gb|AAO50551.1| putative mitochondrial carrier protein [Arabidopsis thaliana] gi|332197448|gb|AEE35569.1| mitochondrial substrate carrier family protein [Arabidopsis thaliana] Length = 364 Score = 95.5 bits (236), Expect = 7e-18 Identities = 40/64 (62%), Positives = 50/64 (78%) Frame = +2 Query: 2 VYVPCEVMKQRMQVQGTRENWDSRVMKENVCKKSGTKMYGYYAGMFQAGCSIWKEQGPRG 181 +YVPCEV+KQRMQ+QGT +W S + + +V + MYGYY GMFQAGCSIWKEQGP+G Sbjct: 147 IYVPCEVIKQRMQIQGTSSSWSSYISRNSVPVQPRGDMYGYYTGMFQAGCSIWKEQGPKG 206 Query: 182 LFIG 193 L+ G Sbjct: 207 LYAG 210 >gb|ACL52927.1| unknown [Zea mays] gi|414865510|tpg|DAA44067.1| TPA: carrier YMR166C [Zea mays] Length = 366 Score = 95.1 bits (235), Expect = 9e-18 Identities = 40/64 (62%), Positives = 51/64 (79%) Frame = +2 Query: 2 VYVPCEVMKQRMQVQGTRENWDSRVMKENVCKKSGTKMYGYYAGMFQAGCSIWKEQGPRG 181 VYVPCEVMKQRMQ+QGT+++W S V K N+ + G +MYGYY GMF AGCSIW++ G +G Sbjct: 148 VYVPCEVMKQRMQIQGTQKSWASAVAKGNISQTHGIEMYGYYNGMFHAGCSIWRDHGLKG 207 Query: 182 LFIG 193 L+ G Sbjct: 208 LYAG 211