BLASTX nr result
ID: Cocculus22_contig00029493
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00029493 (404 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGC78976.1| hypothetical protein (mitochondrion) [Vicia faba] 55 9e-06 >gb|AGC78976.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 96 Score = 54.7 bits (130), Expect(2) = 9e-06 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = +1 Query: 106 SWAMCPERGHLLSGQQSSISC*LLYDGLPCFLGS 207 +WAM PE G LLSGQQSS S LLYDGLPC LGS Sbjct: 53 NWAMFPEGGRLLSGQQSSTSSRLLYDGLPCILGS 86 Score = 20.4 bits (41), Expect(2) = 9e-06 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +3 Query: 201 GLIRSSTLRPS 233 G RSSTLRPS Sbjct: 85 GSARSSTLRPS 95