BLASTX nr result
ID: Cocculus22_contig00029418
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00029418 (300 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267639.1| PREDICTED: probable 2-oxoglutarate/Fe(II)-de... 58 1e-06 >ref|XP_002267639.1| PREDICTED: probable 2-oxoglutarate/Fe(II)-dependent dioxygenase-like [Vitis vinifera] Length = 354 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/56 (51%), Positives = 38/56 (67%) Frame = +3 Query: 6 DEERLSIALFYNPPLRAKIGPVIGGEERSRDSVYQKVVVEDYVLNYYKVSPAKEKQ 173 ++ER S+ALFYNPP +I PV G D Y+KVVV DYV ++Y++SP EKQ Sbjct: 296 EKERFSVALFYNPPCSTEIQPVQDG-----DGGYKKVVVGDYVRHFYEISPTLEKQ 346