BLASTX nr result
ID: Cocculus22_contig00029323
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00029323 (393 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006827182.1| hypothetical protein AMTR_s00010p00256680 [A... 66 4e-09 ref|XP_007213716.1| hypothetical protein PRUPE_ppa000548mg [Prun... 55 8e-06 ref|XP_002527043.1| Ran GTPase binding protein, putative [Ricinu... 55 8e-06 >ref|XP_006827182.1| hypothetical protein AMTR_s00010p00256680 [Amborella trichopoda] gi|548831611|gb|ERM94419.1| hypothetical protein AMTR_s00010p00256680 [Amborella trichopoda] Length = 1080 Score = 66.2 bits (160), Expect = 4e-09 Identities = 37/77 (48%), Positives = 51/77 (66%), Gaps = 2/77 (2%) Frame = -1 Query: 387 SGTASRFCRNQSGSIHHSFNESLDRDNVESRIHGHASRLSSVESFKLAENRH-SKQNRKL 211 +G+ SRF N+SGS++H E+ + ++S+ H SRLSS+ESFK E R SK+NRKL Sbjct: 728 AGSVSRFAGNRSGSLNHRSYEAPENGPLDSKSHAQLSRLSSMESFKHVEGRSVSKRNRKL 787 Query: 210 ESNSH-LPLFDNGKPQW 163 ESNS+ + NG QW Sbjct: 788 ESNSNRVSPIPNGNNQW 804 >ref|XP_007213716.1| hypothetical protein PRUPE_ppa000548mg [Prunus persica] gi|462409581|gb|EMJ14915.1| hypothetical protein PRUPE_ppa000548mg [Prunus persica] Length = 1102 Score = 55.5 bits (132), Expect = 8e-06 Identities = 33/76 (43%), Positives = 47/76 (61%), Gaps = 2/76 (2%) Frame = -1 Query: 381 TASRFCRNQSGSIHHSFNESLDRDN-VESRIHGHASRLSSVESFKLAENRHSKQNRKLES 205 T+S+ ++ GSI+ NE LD+D+ ++SR +R SS+ES K E R SK+N+KLE Sbjct: 724 TSSQTSMSRRGSINQGSNELLDKDDKLDSRSRVQLARFSSMESLKHVETRSSKKNKKLEF 783 Query: 204 N-SHLPLFDNGKPQWG 160 N S + NG QWG Sbjct: 784 NSSRVSPVPNGGSQWG 799 >ref|XP_002527043.1| Ran GTPase binding protein, putative [Ricinus communis] gi|223533605|gb|EEF35343.1| Ran GTPase binding protein, putative [Ricinus communis] Length = 1100 Score = 55.5 bits (132), Expect = 8e-06 Identities = 32/69 (46%), Positives = 45/69 (65%), Gaps = 2/69 (2%) Frame = -1 Query: 360 NQSGSIHHSFNESLDRDN-VESRIHGHASRLSSVESFKLAENRHSKQNRKLESN-SHLPL 187 ++ GS++H NE +D+D ++SR +R SS+ES K AENR SK+N+KLE N S + Sbjct: 730 SRRGSVNHGSNEFIDKDEKLDSRSRAQLARFSSMESLKQAENR-SKRNKKLEFNSSRVSP 788 Query: 186 FDNGKPQWG 160 NG QWG Sbjct: 789 VPNGGSQWG 797