BLASTX nr result
ID: Cocculus22_contig00029285
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00029285 (269 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588269.1| Mitochondrial protein, putative [Medicago tr... 66 6e-09 ref|NP_085560.1| hypothetical protein ArthMp093 [Arabidopsis tha... 60 2e-07 pir||T06502 hypothetical protein 91 - garden pea chloroplast gi|... 55 8e-06 >ref|XP_003588269.1| Mitochondrial protein, putative [Medicago truncatula] gi|355477317|gb|AES58520.1| Mitochondrial protein, putative [Medicago truncatula] Length = 172 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = -2 Query: 268 PGIVVQSVRAPPCQGGSCGFEPRQSRPRI 182 PGIVVQSVRAPPCQGGSCGFEPRQSRPRI Sbjct: 143 PGIVVQSVRAPPCQGGSCGFEPRQSRPRI 171 >ref|NP_085560.1| hypothetical protein ArthMp093 [Arabidopsis thaliana] gi|45477059|sp|P92540.1|M1060_ARATH RecName: Full=Uncharacterized mitochondrial protein AtMg01060; AltName: Full=ORF107g gi|1785762|emb|CAA69792.1| unnamed protein product [Arabidopsis thaliana] Length = 107 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -2 Query: 265 GIVVQSVRAPPCQGGSCGFEPRQSRPRIGWILQ 167 GIVVQSVRAPPCQGGSCGFEPRQSRP +L+ Sbjct: 69 GIVVQSVRAPPCQGGSCGFEPRQSRPSHNCVLR 101 >pir||T06502 hypothetical protein 91 - garden pea chloroplast gi|14205|emb|CAA25831.1| hypothetical protein [Pisum sativum] Length = 91 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 269 PWDCSSIGQSTALSRRKLRVRAPSVP 192 PWDCSSIGQSTALSRRKLRVR PSVP Sbjct: 8 PWDCSSIGQSTALSRRKLRVRVPSVP 33