BLASTX nr result
ID: Cocculus22_contig00029170
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00029170 (283 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004485710.1| PREDICTED: non-specific lipid-transfer prote... 69 9e-10 ref|XP_006374355.1| hypothetical protein POPTR_0015s06360g [Popu... 67 3e-09 gb|EXB56935.1| hypothetical protein L484_019980 [Morus notabilis] 64 2e-08 ref|XP_002276034.1| PREDICTED: uncharacterized GPI-anchored prot... 64 2e-08 ref|XP_007036507.1| Bifunctional inhibitor/lipid-transfer protei... 62 1e-07 ref|XP_007208861.1| hypothetical protein PRUPE_ppa025857mg, part... 60 2e-07 ref|XP_004138342.1| PREDICTED: uncharacterized protein LOC101203... 58 1e-06 >ref|XP_004485710.1| PREDICTED: non-specific lipid-transfer protein-like protein At5g64080-like [Cicer arietinum] Length = 126 Score = 68.6 bits (166), Expect = 9e-10 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -3 Query: 281 PNCLCTLLNDTTFVSFPVNKTLALQLPLLCNLSMNISSCPG 159 P+CLC LLNDT+F SFP+NKTLA+Q+P LC L +N S CPG Sbjct: 80 PHCLCLLLNDTSFTSFPINKTLAMQIPALCKLQLNNSVCPG 120 >ref|XP_006374355.1| hypothetical protein POPTR_0015s06360g [Populus trichocarpa] gi|566206195|ref|XP_006374359.1| protease inhibitor/seed storage/lipid transfer family protein [Populus trichocarpa] gi|550322114|gb|ERP52152.1| hypothetical protein POPTR_0015s06360g [Populus trichocarpa] gi|550322118|gb|ERP52156.1| protease inhibitor/seed storage/lipid transfer family protein [Populus trichocarpa] Length = 205 Score = 67.0 bits (162), Expect = 3e-09 Identities = 28/48 (58%), Positives = 36/48 (75%) Frame = -3 Query: 281 PNCLCTLLNDTTFVSFPVNKTLALQLPLLCNLSMNISSCPGTTATLSS 138 P C+C LL DT SFP+N+TLAL+LP LCN+ +NI++C GT LSS Sbjct: 81 PGCICLLLEDTNLSSFPINRTLALELPALCNVQINIAACSGTPQVLSS 128 >gb|EXB56935.1| hypothetical protein L484_019980 [Morus notabilis] Length = 188 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 9/58 (15%) Frame = -3 Query: 281 PNCLCTLLNDTTFVSFPVNKTLALQLPLLCNLSMNISSC---------PGTTATLSST 135 P CLC LLNDTT SFP+N +LALQLPLLC++ ++IS C PG+ +L ST Sbjct: 67 PRCLCLLLNDTTLSSFPINSSLALQLPLLCSVQIDISVCSAGVNGSTSPGSQVSLGST 124 >ref|XP_002276034.1| PREDICTED: uncharacterized GPI-anchored protein At1g27950 [Vitis vinifera] gi|297734195|emb|CBI15442.3| unnamed protein product [Vitis vinifera] Length = 185 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/49 (63%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = -3 Query: 281 PNCLCTLLNDTTFVSFPVNKTLALQLPLLCNLSMNISSC-PGTTATLSS 138 PNCLC LLN T SFP+N+TLALQLPL+CNL ++IS C G T SS Sbjct: 77 PNCLCLLLNSTVMGSFPINRTLALQLPLVCNLQVSISPCSEGMTVPPSS 125 >ref|XP_007036507.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein, putative [Theobroma cacao] gi|508773752|gb|EOY21008.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein, putative [Theobroma cacao] Length = 193 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/41 (63%), Positives = 30/41 (73%) Frame = -3 Query: 281 PNCLCTLLNDTTFVSFPVNKTLALQLPLLCNLSMNISSCPG 159 P CLC LLNDTT FP+N+T ALQLP+LC L N S+C G Sbjct: 80 PGCLCLLLNDTTLSDFPINRTRALQLPVLCKLQANASACSG 120 >ref|XP_007208861.1| hypothetical protein PRUPE_ppa025857mg, partial [Prunus persica] gi|462404596|gb|EMJ10060.1| hypothetical protein PRUPE_ppa025857mg, partial [Prunus persica] Length = 193 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -3 Query: 281 PNCLCTLLNDTTFVSFPVNKTLALQLPLLCNLSMNISSCPG 159 P+CLC LLN TT SFP+N T ALQLP LC+L ++IS+C G Sbjct: 83 PDCLCLLLNSTTLSSFPINTTRALQLPALCSLQVDISACSG 123 >ref|XP_004138342.1| PREDICTED: uncharacterized protein LOC101203136 [Cucumis sativus] gi|449528112|ref|XP_004171050.1| PREDICTED: uncharacterized protein LOC101224057 [Cucumis sativus] Length = 198 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = -3 Query: 281 PNCLCTLLNDTTFVSFPVNKTLALQLPLLCNLSMNISSC 165 PNCLC LLN T SFP+N T ALQLP +C+L +NIS+C Sbjct: 81 PNCLCLLLNGTNLSSFPINTTRALQLPDICSLQVNISTC 119