BLASTX nr result
ID: Cocculus22_contig00029169
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00029169 (544 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007027969.1| Serine/threonine-protein kinase irlC isoform... 65 1e-08 ref|XP_007027968.1| Serine/threonine-protein kinase irlC isoform... 65 1e-08 ref|XP_002274655.1| PREDICTED: uncharacterized protein LOC100258... 61 2e-07 ref|XP_002532550.1| conserved hypothetical protein [Ricinus comm... 60 5e-07 ref|XP_002323389.2| hypothetical protein POPTR_0016s07140g [Popu... 56 5e-06 >ref|XP_007027969.1| Serine/threonine-protein kinase irlC isoform 2 [Theobroma cacao] gi|508716574|gb|EOY08471.1| Serine/threonine-protein kinase irlC isoform 2 [Theobroma cacao] Length = 304 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/52 (57%), Positives = 38/52 (73%) Frame = -2 Query: 543 DRPSALLLPPVHRPFRNYSASEISSNQSTLSTKDQSLGQTEAYHIGCSLEEA 388 ++ SALLLPPVHRP+R +S S++SS Q+ ST DQS AYHIGC +EA Sbjct: 253 EKQSALLLPPVHRPYRTFSPSKVSSTQAIASTGDQSCSAPGAYHIGCFSDEA 304 >ref|XP_007027968.1| Serine/threonine-protein kinase irlC isoform 1 [Theobroma cacao] gi|508716573|gb|EOY08470.1| Serine/threonine-protein kinase irlC isoform 1 [Theobroma cacao] Length = 429 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/52 (57%), Positives = 38/52 (73%) Frame = -2 Query: 543 DRPSALLLPPVHRPFRNYSASEISSNQSTLSTKDQSLGQTEAYHIGCSLEEA 388 ++ SALLLPPVHRP+R +S S++SS Q+ ST DQS AYHIGC +EA Sbjct: 378 EKQSALLLPPVHRPYRTFSPSKVSSTQAIASTGDQSCSAPGAYHIGCFSDEA 429 >ref|XP_002274655.1| PREDICTED: uncharacterized protein LOC100258667 [Vitis vinifera] gi|296085885|emb|CBI31209.3| unnamed protein product [Vitis vinifera] Length = 419 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/52 (55%), Positives = 38/52 (73%) Frame = -2 Query: 543 DRPSALLLPPVHRPFRNYSASEISSNQSTLSTKDQSLGQTEAYHIGCSLEEA 388 DR S LLLPPV+ P+R++ A + SS QS STK+Q+L + AYH+GC EEA Sbjct: 368 DRQSDLLLPPVYHPYRSFCAIKSSSPQSISSTKNQTLDASHAYHVGCFSEEA 419 >ref|XP_002532550.1| conserved hypothetical protein [Ricinus communis] gi|223527739|gb|EEF29844.1| conserved hypothetical protein [Ricinus communis] Length = 434 Score = 59.7 bits (143), Expect = 5e-07 Identities = 29/51 (56%), Positives = 34/51 (66%) Frame = -2 Query: 543 DRPSALLLPPVHRPFRNYSASEISSNQSTLSTKDQSLGQTEAYHIGCSLEE 391 DR S+LLLPPVHRP+R++S E S Q STKDQ L AYH GC E+ Sbjct: 383 DRKSSLLLPPVHRPYRHFSPLESPSTQPISSTKDQGLDFPGAYHTGCFSED 433 >ref|XP_002323389.2| hypothetical protein POPTR_0016s07140g [Populus trichocarpa] gi|550321025|gb|EEF05150.2| hypothetical protein POPTR_0016s07140g [Populus trichocarpa] Length = 436 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/51 (50%), Positives = 34/51 (66%) Frame = -2 Query: 543 DRPSALLLPPVHRPFRNYSASEISSNQSTLSTKDQSLGQTEAYHIGCSLEE 391 DR S LLLPPV+RP+ ++S +I+S Q+ S KD L A+HIGC EE Sbjct: 385 DRKSMLLLPPVYRPYLHFSTLQIASTQTNSSAKDHGLENLGAFHIGCFTEE 435