BLASTX nr result
ID: Cocculus22_contig00029021
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00029021 (300 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN70510.1| hypothetical protein VITISV_023158 [Vitis vinifera] 75 7e-12 emb|CAN65797.1| hypothetical protein VITISV_014905 [Vitis vinifera] 65 1e-08 ref|XP_002525119.1| Adaptin ear-binding coat-associated protein,... 63 4e-08 >emb|CAN70510.1| hypothetical protein VITISV_023158 [Vitis vinifera] Length = 790 Score = 75.5 bits (184), Expect = 7e-12 Identities = 38/72 (52%), Positives = 49/72 (68%), Gaps = 3/72 (4%) Frame = +2 Query: 17 SLNFPPISDSSTDLPQTKAILDSRIIRKGKYQLKKKF---W*SIGTLEEDATWEYKWRFS 187 S P +SD+ST LPQ +A+LD R+I KGKY+ K + W +G EDATWE +W F+ Sbjct: 720 STQLPLVSDTSTVLPQPEAVLDRRVIHKGKYRPKFEILVKW--VGVPAEDATWENEWCFT 777 Query: 188 KMYPNFILADKD 223 K YP+FIL DKD Sbjct: 778 KSYPDFILVDKD 789 >emb|CAN65797.1| hypothetical protein VITISV_014905 [Vitis vinifera] Length = 268 Score = 64.7 bits (156), Expect = 1e-08 Identities = 33/68 (48%), Positives = 45/68 (66%), Gaps = 3/68 (4%) Frame = +2 Query: 17 SLNFPPISDSSTDLPQTKAILDSRIIRKGKYQLKKKF---W*SIGTLEEDATWEYKWRFS 187 S PP+SD+ST LPQ +A+LD R+I KGKY+ K + W +G EDATWE +WRF+ Sbjct: 95 STQLPPVSDTSTVLPQPEAVLDRRVIHKGKYRPKSEILVKW--VGAPAEDATWENEWRFT 152 Query: 188 KMYPNFIL 211 NF++ Sbjct: 153 ----NFVV 156 >ref|XP_002525119.1| Adaptin ear-binding coat-associated protein, putative [Ricinus communis] gi|223535578|gb|EEF37246.1| Adaptin ear-binding coat-associated protein, putative [Ricinus communis] Length = 546 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/63 (49%), Positives = 42/63 (66%), Gaps = 3/63 (4%) Frame = +2 Query: 29 PPISDSSTDLPQTKAILDSRIIRKGKYQLKKKF---W*SIGTLEEDATWEYKWRFSKMYP 199 PP+SD S LPQ +A+LD R+I+KGKY+ K W G EDATWE +WRF+K Y Sbjct: 18 PPVSDDSIILPQPEAVLDRRVIQKGKYRPKSDVLIKW--KGAPREDATWENEWRFTKSYL 75 Query: 200 NFI 208 +++ Sbjct: 76 DYL 78