BLASTX nr result
ID: Cocculus22_contig00028908
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00028908 (426 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007048873.1| WRKY DNA-binding protein 28, putative [Theob... 62 6e-08 >ref|XP_007048873.1| WRKY DNA-binding protein 28, putative [Theobroma cacao] gi|508701134|gb|EOX93030.1| WRKY DNA-binding protein 28, putative [Theobroma cacao] Length = 316 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/58 (51%), Positives = 39/58 (67%) Frame = +1 Query: 67 FPLFFTDPSLFNQASAPTFTPSSISQQGLQRFDPQNMSFTDCLQDSMDYSTIARAFDI 240 FP F +PS++NQA+A P+ Q Q FDP MSFTDCL S+DY++ +RAFDI Sbjct: 23 FPFFDDNPSMYNQAAAALTAPT----QNFQGFDPSYMSFTDCLHGSVDYNSFSRAFDI 76