BLASTX nr result
ID: Cocculus22_contig00028868
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00028868 (669 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534237.1| conserved hypothetical protein [Ricinus comm... 60 8e-07 gb|EYU18800.1| hypothetical protein MIMGU_mgv1a022992mg [Mimulus... 58 2e-06 ref|XP_006379540.1| hypothetical protein POPTR_0008s03590g [Popu... 58 2e-06 gb|EXC31770.1| hypothetical protein L484_020594 [Morus notabilis] 58 3e-06 >ref|XP_002534237.1| conserved hypothetical protein [Ricinus communis] gi|223525657|gb|EEF28144.1| conserved hypothetical protein [Ricinus communis] Length = 106 Score = 59.7 bits (143), Expect = 8e-07 Identities = 27/71 (38%), Positives = 43/71 (60%) Frame = -1 Query: 501 NQKSLMVAEASRILVPKPLQDYAVLKNRSDRNQKGYQGREIRNCMPKGFRRSSAPSRYIN 322 N S + A+R L K ++ + ++ +KG++GR++ NC+PKGF R+SAPSRYIN Sbjct: 29 NATSRVAVAAARPLPSKSSKELVAFRPKTTHGRKGFRGRDVENCLPKGFHRTSAPSRYIN 88 Query: 321 HHIDRYMPCSS 289 + CS+ Sbjct: 89 YDTLGATMCST 99 >gb|EYU18800.1| hypothetical protein MIMGU_mgv1a022992mg [Mimulus guttatus] Length = 92 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/52 (51%), Positives = 39/52 (75%), Gaps = 1/52 (1%) Frame = -1 Query: 441 DYAVLK-NRSDRNQKGYQGREIRNCMPKGFRRSSAPSRYINHHIDRYMPCSS 289 D+A LK + SD ++ ++ R+I+NCMPKG RRSSAPSRY+N+H + CS+ Sbjct: 37 DFATLKPSDSDHKKRVFRQRDIKNCMPKGSRRSSAPSRYVNYHALGSLRCST 88 >ref|XP_006379540.1| hypothetical protein POPTR_0008s03590g [Populus trichocarpa] gi|550332357|gb|ERP57337.1| hypothetical protein POPTR_0008s03590g [Populus trichocarpa] Length = 103 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/56 (50%), Positives = 39/56 (69%) Frame = -1 Query: 483 VAEASRILVPKPLQDYAVLKNRSDRNQKGYQGREIRNCMPKGFRRSSAPSRYINHH 316 VA A+R L K + Y LK +++ Q+ + GRE+ NC+PKGF +SAPSRYIN+H Sbjct: 33 VAVATRPLESKSSR-YETLKPKTNHGQQEFHGREVENCLPKGFHPTSAPSRYINYH 87 >gb|EXC31770.1| hypothetical protein L484_020594 [Morus notabilis] Length = 82 Score = 57.8 bits (138), Expect = 3e-06 Identities = 33/72 (45%), Positives = 47/72 (65%), Gaps = 4/72 (5%) Frame = -1 Query: 468 RILVPKPLQDYAVLKNRSDRNQKGY-QGREIRNCMPKGFRRSSAPSRYINHHIDRYMP-- 298 R LV + QD L+ R + +K + +GREI+ C+PKGFR +SAPSR++N Y+P Sbjct: 16 RPLVAEVDQDLVSLRPRLNPGKKQFFRGREIKGCLPKGFRHASAPSRFVN-----YLPLG 70 Query: 297 -CSSSTKDSRKP 265 CSS+ K S+KP Sbjct: 71 GCSSTRKHSKKP 82