BLASTX nr result
ID: Cocculus22_contig00028723
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00028723 (414 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004303610.1| PREDICTED: LOW QUALITY PROTEIN: regulatory p... 73 5e-11 ref|XP_004136653.1| PREDICTED: regulatory protein NPR5-like [Cuc... 71 2e-10 ref|XP_004249233.1| PREDICTED: regulatory protein NPR5-like [Sol... 70 2e-10 gb|EXB93992.1| Regulatory protein [Morus notabilis] 70 3e-10 ref|XP_004249234.1| PREDICTED: regulatory protein NPR5-like [Sol... 70 3e-10 gb|ACU32462.1| NPR1 protein [Brassica rapa subsp. pekinensis] 70 3e-10 ref|XP_006351282.1| PREDICTED: regulatory protein NPR5-like [Sol... 70 4e-10 ref|XP_006411403.1| hypothetical protein EUTSA_v10016568mg [Eutr... 70 4e-10 ref|XP_007028566.1| Ankyrin repeat family protein / BTB/POZ doma... 70 4e-10 ref|XP_006294095.1| hypothetical protein CARUB_v10023088mg [Caps... 70 4e-10 ref|XP_002881770.1| hypothetical protein ARALYDRAFT_903451 [Arab... 70 4e-10 ref|XP_007162101.1| hypothetical protein PHAVU_001G124100g [Phas... 69 5e-10 gb|AGO64649.1| blade-on-petiole [Lupinus luteus] 69 5e-10 gb|AFK30389.1| BOP3 [Nicotiana tabacum] 69 5e-10 gb|AEM62768.1| BTB/POZ ankyrin repeat protein [Lotus japonicus] 69 5e-10 ref|XP_006402903.1| hypothetical protein EUTSA_v10005948mg [Eutr... 69 9e-10 gb|AAO22795.1| unknown protein [Arabidopsis thaliana] 69 9e-10 ref|NP_181668.1| NPR1 like protein BOP2 [Arabidopsis thaliana] g... 69 9e-10 ref|XP_006292732.1| hypothetical protein CARUB_v10018976mg [Caps... 68 1e-09 gb|AFK30390.1| BOP4 [Nicotiana tabacum] 68 1e-09 >ref|XP_004303610.1| PREDICTED: LOW QUALITY PROTEIN: regulatory protein NPR5-like [Fragaria vesca subsp. vesca] Length = 506 Score = 72.8 bits (177), Expect = 5e-11 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -1 Query: 114 MSSLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRLVH 1 MSSLEDS +SLSLDYLNLLINGQAFSDVTFSVEGRLVH Sbjct: 1 MSSLEDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVH 38 >ref|XP_004136653.1| PREDICTED: regulatory protein NPR5-like [Cucumis sativus] gi|449521373|ref|XP_004167704.1| PREDICTED: regulatory protein NPR5-like [Cucumis sativus] Length = 487 Score = 70.9 bits (172), Expect = 2e-10 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -1 Query: 114 MSSLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRLVH 1 MS LEDS +SLSLDYLNLLINGQAFSDVTFSVEGRLVH Sbjct: 1 MSHLEDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVH 38 >ref|XP_004249233.1| PREDICTED: regulatory protein NPR5-like [Solanum lycopersicum] Length = 488 Score = 70.5 bits (171), Expect = 2e-10 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -1 Query: 114 MSSLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRLVH 1 M++LEDS K+LSLDYLNLLINGQAFSDVTFSVEGRLVH Sbjct: 1 MNTLEDSLKTLSLDYLNLLINGQAFSDVTFSVEGRLVH 38 >gb|EXB93992.1| Regulatory protein [Morus notabilis] Length = 501 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -1 Query: 114 MSSLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRLVH 1 MSSLE+S +SLSLDYLNLLINGQAFSDVTF+VEGRLVH Sbjct: 1 MSSLEESMRSLSLDYLNLLINGQAFSDVTFNVEGRLVH 38 >ref|XP_004249234.1| PREDICTED: regulatory protein NPR5-like [Solanum lycopersicum] Length = 494 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -1 Query: 114 MSSLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRLVH 1 M++LEDS K+LSLDYLNLLINGQAFSDVTFSVEGRL+H Sbjct: 1 MNTLEDSLKTLSLDYLNLLINGQAFSDVTFSVEGRLIH 38 >gb|ACU32462.1| NPR1 protein [Brassica rapa subsp. pekinensis] Length = 462 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -1 Query: 135 K*KEEETMSSLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRLVH 1 K ++E SS+E+S KS+SLDYLNLLINGQAFSDVTF+VEGRLVH Sbjct: 2 KNQQEAMSSSIEESLKSMSLDYLNLLINGQAFSDVTFNVEGRLVH 46 >ref|XP_006351282.1| PREDICTED: regulatory protein NPR5-like [Solanum tuberosum] Length = 487 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -1 Query: 111 SSLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRLVH 1 S+LEDS K+LSLDYLNLLINGQAFSDVTFSVEGRLVH Sbjct: 3 STLEDSLKTLSLDYLNLLINGQAFSDVTFSVEGRLVH 39 >ref|XP_006411403.1| hypothetical protein EUTSA_v10016568mg [Eutrema salsugineum] gi|557112572|gb|ESQ52856.1| hypothetical protein EUTSA_v10016568mg [Eutrema salsugineum] Length = 492 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -1 Query: 114 MSSLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRLVH 1 MSSLE+S +SLSLD+LNLLINGQAFSDVTFSVEGRLVH Sbjct: 1 MSSLEESLRSLSLDFLNLLINGQAFSDVTFSVEGRLVH 38 >ref|XP_007028566.1| Ankyrin repeat family protein / BTB/POZ domain-containing protein [Theobroma cacao] gi|508717171|gb|EOY09068.1| Ankyrin repeat family protein / BTB/POZ domain-containing protein [Theobroma cacao] Length = 481 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -1 Query: 114 MSSLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRLVH 1 MSS E+S +SLSLDYLNLLINGQAFSDVTFSVEGRLVH Sbjct: 1 MSSFEESLRSLSLDYLNLLINGQAFSDVTFSVEGRLVH 38 >ref|XP_006294095.1| hypothetical protein CARUB_v10023088mg [Capsella rubella] gi|482562803|gb|EOA26993.1| hypothetical protein CARUB_v10023088mg [Capsella rubella] Length = 491 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -1 Query: 114 MSSLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRLVH 1 MSSLE+S +SLSLD+LNLLINGQAFSDVTFSVEGRLVH Sbjct: 1 MSSLEESLRSLSLDFLNLLINGQAFSDVTFSVEGRLVH 38 >ref|XP_002881770.1| hypothetical protein ARALYDRAFT_903451 [Arabidopsis lyrata subsp. lyrata] gi|297327609|gb|EFH58029.1| hypothetical protein ARALYDRAFT_903451 [Arabidopsis lyrata subsp. lyrata] Length = 491 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -1 Query: 114 MSSLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRLVH 1 MSSLE+S +SLSLD+LNLLINGQAFSDVTFSVEGRLVH Sbjct: 1 MSSLEESLRSLSLDFLNLLINGQAFSDVTFSVEGRLVH 38 >ref|XP_007162101.1| hypothetical protein PHAVU_001G124100g [Phaseolus vulgaris] gi|561035565|gb|ESW34095.1| hypothetical protein PHAVU_001G124100g [Phaseolus vulgaris] Length = 475 Score = 69.3 bits (168), Expect = 5e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -1 Query: 108 SLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRLVH 1 SLEDS +SLSLDYLNLLINGQAFSDVTFSVEGRLVH Sbjct: 2 SLEDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVH 37 >gb|AGO64649.1| blade-on-petiole [Lupinus luteus] Length = 486 Score = 69.3 bits (168), Expect = 5e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -1 Query: 108 SLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRLVH 1 SLEDS +SLSLDYLNLLINGQAFSDVTFSVEGRLVH Sbjct: 2 SLEDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVH 37 >gb|AFK30389.1| BOP3 [Nicotiana tabacum] Length = 488 Score = 69.3 bits (168), Expect = 5e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -1 Query: 108 SLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRLVH 1 +LEDS KSLSLDYLNLLINGQAFSDVTFSVEGRLVH Sbjct: 2 TLEDSLKSLSLDYLNLLINGQAFSDVTFSVEGRLVH 37 >gb|AEM62768.1| BTB/POZ ankyrin repeat protein [Lotus japonicus] Length = 483 Score = 69.3 bits (168), Expect = 5e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -1 Query: 108 SLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRLVH 1 SLEDS +SLSLDYLNLLINGQAFSDVTFSVEGRLVH Sbjct: 2 SLEDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVH 37 >ref|XP_006402903.1| hypothetical protein EUTSA_v10005948mg [Eutrema salsugineum] gi|557104002|gb|ESQ44356.1| hypothetical protein EUTSA_v10005948mg [Eutrema salsugineum] Length = 469 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -1 Query: 111 SSLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRLVH 1 SS+E++ KSLSLDYLNLLINGQAFSDVTFSVEGRLVH Sbjct: 3 SSIEETLKSLSLDYLNLLINGQAFSDVTFSVEGRLVH 39 >gb|AAO22795.1| unknown protein [Arabidopsis thaliana] Length = 491 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -1 Query: 114 MSSLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRLVH 1 MS+LE+S +SLSLD+LNLLINGQAFSDVTFSVEGRLVH Sbjct: 1 MSNLEESLRSLSLDFLNLLINGQAFSDVTFSVEGRLVH 38 >ref|NP_181668.1| NPR1 like protein BOP2 [Arabidopsis thaliana] gi|75315939|sp|Q9ZVC2.1|NPR5_ARATH RecName: Full=Regulatory protein NPR5; AltName: Full=BTB/POZ domain-containing protein NPR5; AltName: Full=Protein BLADE ON PETIOLE 2 gi|3894187|gb|AAC78536.1| hypothetical protein [Arabidopsis thaliana] gi|53749156|gb|AAU90063.1| At2g41370 [Arabidopsis thaliana] gi|60545031|gb|AAX22759.1| BLADE-ON-PETIOLE2 [Arabidopsis thaliana] gi|330254872|gb|AEC09966.1| NPR1 like protein BOP2 [Arabidopsis thaliana] Length = 491 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -1 Query: 114 MSSLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRLVH 1 MS+LE+S +SLSLD+LNLLINGQAFSDVTFSVEGRLVH Sbjct: 1 MSNLEESLRSLSLDFLNLLINGQAFSDVTFSVEGRLVH 38 >ref|XP_006292732.1| hypothetical protein CARUB_v10018976mg [Capsella rubella] gi|482561439|gb|EOA25630.1| hypothetical protein CARUB_v10018976mg [Capsella rubella] Length = 468 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -1 Query: 111 SSLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRLVH 1 SS E+S KS+SLDYLNLLINGQAFSDVTFSVEGRLVH Sbjct: 4 SSFEESLKSMSLDYLNLLINGQAFSDVTFSVEGRLVH 40 >gb|AFK30390.1| BOP4 [Nicotiana tabacum] Length = 488 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 108 SLEDSFKSLSLDYLNLLINGQAFSDVTFSVEGRLVH 1 +LEDS +SLSLDYLNLLINGQAFSDVTFSVEGRLVH Sbjct: 2 TLEDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVH 37