BLASTX nr result
ID: Cocculus22_contig00028509
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00028509 (384 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007212227.1| hypothetical protein PRUPE_ppa013351mg [Prun... 55 8e-06 >ref|XP_007212227.1| hypothetical protein PRUPE_ppa013351mg [Prunus persica] gi|462408092|gb|EMJ13426.1| hypothetical protein PRUPE_ppa013351mg [Prunus persica] Length = 127 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/59 (47%), Positives = 33/59 (55%) Frame = +3 Query: 126 EMMGVWRWMVRKTRG*TPFFIASKTXXXXXXXXXXXXXTQTTSSHNEELEAYLCKNARP 302 E G WRW+V KTR PFF+A T QTT+S NE+LEA L +NARP Sbjct: 6 EKSGTWRWIVNKTRDSKPFFLAFATVCGVVPGVIGYFVMQTTNSRNEQLEAELRRNARP 64