BLASTX nr result
ID: Cocculus22_contig00028403
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00028403 (418 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB38634.1| hypothetical protein L484_014448 [Morus notabilis] 55 8e-06 >gb|EXB38634.1| hypothetical protein L484_014448 [Morus notabilis] Length = 321 Score = 55.5 bits (132), Expect = 8e-06 Identities = 35/67 (52%), Positives = 40/67 (59%), Gaps = 1/67 (1%) Frame = +1 Query: 220 PVCAERSRLLVFFEKLSYFSTA-TNPRISNILDAESESDESMVYRQKLLFQRPTTIRWQD 396 P+ + R + F SY +TA TNPR N ESE S VY+ L FQRPTTIRWQD Sbjct: 57 PLLSSHQRFVPFS---SYPATAATNPRFRNSFFDESEGS-SAVYKHALKFQRPTTIRWQD 112 Query: 397 RLCNSVS 417 RL NS S Sbjct: 113 RLFNSAS 119