BLASTX nr result
ID: Cocculus22_contig00028249
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00028249 (279 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004232407.1| PREDICTED: 60S ribosomal protein L6, mitocho... 127 1e-27 ref|XP_002267044.1| PREDICTED: 60S ribosomal protein L6, mitocho... 126 3e-27 emb|CAN72978.1| hypothetical protein VITISV_009029 [Vitis vinifera] 126 4e-27 gb|EYU28949.1| hypothetical protein MIMGU_mgv1a016906mg [Mimulus... 123 3e-26 gb|EPS73260.1| hypothetical protein M569_01499 [Genlisea aurea] 123 3e-26 gb|EPS73259.1| hypothetical protein M569_01498 [Genlisea aurea] 123 3e-26 ref|XP_002527470.1| 50S ribosomal protein L6, putative [Ricinus ... 123 3e-26 gb|EXC30991.1| 60S ribosomal protein L6 [Morus notabilis] 122 7e-26 ref|XP_002310235.1| hypothetical protein POPTR_0007s12890g [Popu... 120 2e-25 ref|XP_007034223.1| Ribosomal protein L6 family protein [Theobro... 119 3e-25 ref|XP_004143514.1| PREDICTED: 60S ribosomal protein L6, mitocho... 119 3e-25 ref|NP_001235881.1| uncharacterized protein LOC100527168 [Glycin... 119 4e-25 ref|XP_007202741.1| hypothetical protein PRUPE_ppa013193mg [Prun... 119 6e-25 ref|XP_007202740.1| hypothetical protein PRUPE_ppa013193mg [Prun... 119 6e-25 ref|XP_004290502.1| PREDICTED: 60S ribosomal protein L6, mitocho... 118 1e-24 ref|XP_007144238.1| hypothetical protein PHAVU_007G139500g [Phas... 117 2e-24 ref|XP_006847191.1| hypothetical protein AMTR_s00017p00249300 [A... 117 2e-24 ref|XP_004300468.1| PREDICTED: 60S ribosomal protein L6, mitocho... 117 2e-24 gb|AFK46285.1| unknown [Medicago truncatula] 117 2e-24 ref|XP_003536284.1| PREDICTED: 60S ribosomal protein L6, mitocho... 117 2e-24 >ref|XP_004232407.1| PREDICTED: 60S ribosomal protein L6, mitochondrial-like [Solanum lycopersicum] gi|565347196|ref|XP_006340619.1| PREDICTED: 60S ribosomal protein L6, mitochondrial-like [Solanum tuberosum] Length = 102 Score = 127 bits (320), Expect = 1e-27 Identities = 60/61 (98%), Positives = 61/61 (100%) Frame = +1 Query: 97 MEAKFFRFLKIVGVGFKARAESEGRLLYLKLGYSHEVELTVPPAVRVFCFKPNIVCCTGI 276 MEAKFFRFLKIVGVGFKARAESEGRLLYLKLGYSHEVELTVPPAVRVFCFKPN+VCCTGI Sbjct: 1 MEAKFFRFLKIVGVGFKARAESEGRLLYLKLGYSHEVELTVPPAVRVFCFKPNVVCCTGI 60 Query: 277 D 279 D Sbjct: 61 D 61 >ref|XP_002267044.1| PREDICTED: 60S ribosomal protein L6, mitochondrial [Vitis vinifera] gi|297735153|emb|CBI17515.3| unnamed protein product [Vitis vinifera] Length = 102 Score = 126 bits (317), Expect = 3e-27 Identities = 60/61 (98%), Positives = 61/61 (100%) Frame = +1 Query: 97 MEAKFFRFLKIVGVGFKARAESEGRLLYLKLGYSHEVELTVPPAVRVFCFKPNIVCCTGI 276 MEAKFFRFLKIVGVGFKARAESEGRLL+LKLGYSHEVELTVPPAVRVFCFKPNIVCCTGI Sbjct: 1 MEAKFFRFLKIVGVGFKARAESEGRLLFLKLGYSHEVELTVPPAVRVFCFKPNIVCCTGI 60 Query: 277 D 279 D Sbjct: 61 D 61 >emb|CAN72978.1| hypothetical protein VITISV_009029 [Vitis vinifera] Length = 102 Score = 126 bits (316), Expect = 4e-27 Identities = 59/61 (96%), Positives = 61/61 (100%) Frame = +1 Query: 97 MEAKFFRFLKIVGVGFKARAESEGRLLYLKLGYSHEVELTVPPAVRVFCFKPNIVCCTGI 276 MEAKFFRFLKIVGVGFKARAESEGRLL+LKLGYSHEVELTVPPAVRVFCFKPN+VCCTGI Sbjct: 1 MEAKFFRFLKIVGVGFKARAESEGRLLFLKLGYSHEVELTVPPAVRVFCFKPNVVCCTGI 60 Query: 277 D 279 D Sbjct: 61 D 61 >gb|EYU28949.1| hypothetical protein MIMGU_mgv1a016906mg [Mimulus guttatus] gi|604336375|gb|EYU40160.1| hypothetical protein MIMGU_mgv1a016908mg [Mimulus guttatus] Length = 102 Score = 123 bits (308), Expect = 3e-26 Identities = 58/61 (95%), Positives = 60/61 (98%) Frame = +1 Query: 97 MEAKFFRFLKIVGVGFKARAESEGRLLYLKLGYSHEVELTVPPAVRVFCFKPNIVCCTGI 276 MEAKFFRFLKIVGVGFKARAE+EGRLLYLKLGYSHEVELTVPPAVRVFCFK N+VCCTGI Sbjct: 1 MEAKFFRFLKIVGVGFKARAEAEGRLLYLKLGYSHEVELTVPPAVRVFCFKNNVVCCTGI 60 Query: 277 D 279 D Sbjct: 61 D 61 >gb|EPS73260.1| hypothetical protein M569_01499 [Genlisea aurea] Length = 102 Score = 123 bits (308), Expect = 3e-26 Identities = 58/61 (95%), Positives = 60/61 (98%) Frame = +1 Query: 97 MEAKFFRFLKIVGVGFKARAESEGRLLYLKLGYSHEVELTVPPAVRVFCFKPNIVCCTGI 276 MEAKFFRFLKIVGVGFKARAE+EGRLLYLKLGYSHEVELTVPPAVRVFCFK N+VCCTGI Sbjct: 1 MEAKFFRFLKIVGVGFKARAEAEGRLLYLKLGYSHEVELTVPPAVRVFCFKNNVVCCTGI 60 Query: 277 D 279 D Sbjct: 61 D 61 >gb|EPS73259.1| hypothetical protein M569_01498 [Genlisea aurea] Length = 102 Score = 123 bits (308), Expect = 3e-26 Identities = 58/61 (95%), Positives = 60/61 (98%) Frame = +1 Query: 97 MEAKFFRFLKIVGVGFKARAESEGRLLYLKLGYSHEVELTVPPAVRVFCFKPNIVCCTGI 276 MEAKFFRFLKIVGVGFKARAE+EGRLLYLKLGYSHEVELTVPPAVRVFCFK N+VCCTGI Sbjct: 1 MEAKFFRFLKIVGVGFKARAEAEGRLLYLKLGYSHEVELTVPPAVRVFCFKNNVVCCTGI 60 Query: 277 D 279 D Sbjct: 61 D 61 >ref|XP_002527470.1| 50S ribosomal protein L6, putative [Ricinus communis] gi|223533110|gb|EEF34868.1| 50S ribosomal protein L6, putative [Ricinus communis] Length = 102 Score = 123 bits (308), Expect = 3e-26 Identities = 58/61 (95%), Positives = 60/61 (98%) Frame = +1 Query: 97 MEAKFFRFLKIVGVGFKARAESEGRLLYLKLGYSHEVELTVPPAVRVFCFKPNIVCCTGI 276 MEAKFFRFLKIVGVG+KARAESEGRLLYLKLGYSHEVELTVPPAVRVFCFK N+VCCTGI Sbjct: 1 MEAKFFRFLKIVGVGYKARAESEGRLLYLKLGYSHEVELTVPPAVRVFCFKNNVVCCTGI 60 Query: 277 D 279 D Sbjct: 61 D 61 >gb|EXC30991.1| 60S ribosomal protein L6 [Morus notabilis] Length = 102 Score = 122 bits (305), Expect = 7e-26 Identities = 57/61 (93%), Positives = 60/61 (98%) Frame = +1 Query: 97 MEAKFFRFLKIVGVGFKARAESEGRLLYLKLGYSHEVELTVPPAVRVFCFKPNIVCCTGI 276 MEAKFFRFLKIVGVG+KARAES+GRLLYLKLGYSHEVELTVPPAVRVFCFK N+VCCTGI Sbjct: 1 MEAKFFRFLKIVGVGYKARAESQGRLLYLKLGYSHEVELTVPPAVRVFCFKNNVVCCTGI 60 Query: 277 D 279 D Sbjct: 61 D 61 >ref|XP_002310235.1| hypothetical protein POPTR_0007s12890g [Populus trichocarpa] gi|566181018|ref|XP_006380761.1| hypothetical protein POPTR_0007s12890g [Populus trichocarpa] gi|566181021|ref|XP_006380762.1| ribosomal protein L6 [Populus trichocarpa] gi|118485475|gb|ABK94593.1| unknown [Populus trichocarpa] gi|118486815|gb|ABK95242.1| unknown [Populus trichocarpa] gi|222853138|gb|EEE90685.1| hypothetical protein POPTR_0007s12890g [Populus trichocarpa] gi|550334757|gb|ERP58558.1| hypothetical protein POPTR_0007s12890g [Populus trichocarpa] gi|550334758|gb|ERP58559.1| ribosomal protein L6 [Populus trichocarpa] Length = 102 Score = 120 bits (301), Expect = 2e-25 Identities = 56/61 (91%), Positives = 60/61 (98%) Frame = +1 Query: 97 MEAKFFRFLKIVGVGFKARAESEGRLLYLKLGYSHEVELTVPPAVRVFCFKPNIVCCTGI 276 MEAKFFRFLKIVGVG+KARAE+EGRLL+LKLGYSHEVELTVPPAVRVFCFK N+VCCTGI Sbjct: 1 MEAKFFRFLKIVGVGYKARAEAEGRLLFLKLGYSHEVELTVPPAVRVFCFKNNVVCCTGI 60 Query: 277 D 279 D Sbjct: 61 D 61 >ref|XP_007034223.1| Ribosomal protein L6 family protein [Theobroma cacao] gi|508713252|gb|EOY05149.1| Ribosomal protein L6 family protein [Theobroma cacao] Length = 102 Score = 119 bits (299), Expect = 3e-25 Identities = 55/61 (90%), Positives = 60/61 (98%) Frame = +1 Query: 97 MEAKFFRFLKIVGVGFKARAESEGRLLYLKLGYSHEVELTVPPAVRVFCFKPNIVCCTGI 276 MEAKFFRFLKIVGVG+KARAE+EGRLL+LKLGYSHEVELTVPPAVRVFCFK N+VCCTG+ Sbjct: 1 MEAKFFRFLKIVGVGYKARAEAEGRLLFLKLGYSHEVELTVPPAVRVFCFKNNVVCCTGL 60 Query: 277 D 279 D Sbjct: 61 D 61 >ref|XP_004143514.1| PREDICTED: 60S ribosomal protein L6, mitochondrial-like [Cucumis sativus] gi|449496483|ref|XP_004160146.1| PREDICTED: 60S ribosomal protein L6, mitochondrial-like [Cucumis sativus] Length = 102 Score = 119 bits (299), Expect = 3e-25 Identities = 56/61 (91%), Positives = 59/61 (96%) Frame = +1 Query: 97 MEAKFFRFLKIVGVGFKARAESEGRLLYLKLGYSHEVELTVPPAVRVFCFKPNIVCCTGI 276 MEAKFFRFLKIVGVG+KARAE+ GRLLYLKLGYSHEVELTVPPAVRVFCFK N+VCCTGI Sbjct: 1 MEAKFFRFLKIVGVGYKARAEAAGRLLYLKLGYSHEVELTVPPAVRVFCFKNNVVCCTGI 60 Query: 277 D 279 D Sbjct: 61 D 61 >ref|NP_001235881.1| uncharacterized protein LOC100527168 [Glycine max] gi|255631702|gb|ACU16218.1| unknown [Glycine max] Length = 102 Score = 119 bits (298), Expect = 4e-25 Identities = 55/61 (90%), Positives = 59/61 (96%) Frame = +1 Query: 97 MEAKFFRFLKIVGVGFKARAESEGRLLYLKLGYSHEVELTVPPAVRVFCFKPNIVCCTGI 276 MEAKFFRFLKIVGVG+KARAE+ GRLLYLKLGYSHEVELTVPPAVRVFCFK N++CCTGI Sbjct: 1 MEAKFFRFLKIVGVGYKARAEAAGRLLYLKLGYSHEVELTVPPAVRVFCFKNNVICCTGI 60 Query: 277 D 279 D Sbjct: 61 D 61 >ref|XP_007202741.1| hypothetical protein PRUPE_ppa013193mg [Prunus persica] gi|462398272|gb|EMJ03940.1| hypothetical protein PRUPE_ppa013193mg [Prunus persica] Length = 135 Score = 119 bits (297), Expect = 6e-25 Identities = 56/61 (91%), Positives = 59/61 (96%) Frame = +1 Query: 97 MEAKFFRFLKIVGVGFKARAESEGRLLYLKLGYSHEVELTVPPAVRVFCFKPNIVCCTGI 276 MEAKFFRFLKIVGVG+KARAE+EGRLL LKLGYSHEVELTVPPAVRVFCFK N+VCCTGI Sbjct: 34 MEAKFFRFLKIVGVGYKARAEAEGRLLLLKLGYSHEVELTVPPAVRVFCFKNNVVCCTGI 93 Query: 277 D 279 D Sbjct: 94 D 94 >ref|XP_007202740.1| hypothetical protein PRUPE_ppa013193mg [Prunus persica] gi|462398271|gb|EMJ03939.1| hypothetical protein PRUPE_ppa013193mg [Prunus persica] Length = 102 Score = 119 bits (297), Expect = 6e-25 Identities = 56/61 (91%), Positives = 59/61 (96%) Frame = +1 Query: 97 MEAKFFRFLKIVGVGFKARAESEGRLLYLKLGYSHEVELTVPPAVRVFCFKPNIVCCTGI 276 MEAKFFRFLKIVGVG+KARAE+EGRLL LKLGYSHEVELTVPPAVRVFCFK N+VCCTGI Sbjct: 1 MEAKFFRFLKIVGVGYKARAEAEGRLLLLKLGYSHEVELTVPPAVRVFCFKNNVVCCTGI 60 Query: 277 D 279 D Sbjct: 61 D 61 >ref|XP_004290502.1| PREDICTED: 60S ribosomal protein L6, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 102 Score = 118 bits (295), Expect = 1e-24 Identities = 54/61 (88%), Positives = 60/61 (98%) Frame = +1 Query: 97 MEAKFFRFLKIVGVGFKARAESEGRLLYLKLGYSHEVELTVPPAVRVFCFKPNIVCCTGI 276 MEA+FF+FLKIVGVG+KARAE++GRLLYLKLGYSHEVELTVPPAVRVFCFK N+VCCTGI Sbjct: 1 MEAQFFKFLKIVGVGYKARAEAQGRLLYLKLGYSHEVELTVPPAVRVFCFKNNVVCCTGI 60 Query: 277 D 279 D Sbjct: 61 D 61 >ref|XP_007144238.1| hypothetical protein PHAVU_007G139500g [Phaseolus vulgaris] gi|561017428|gb|ESW16232.1| hypothetical protein PHAVU_007G139500g [Phaseolus vulgaris] Length = 102 Score = 117 bits (293), Expect = 2e-24 Identities = 54/61 (88%), Positives = 58/61 (95%) Frame = +1 Query: 97 MEAKFFRFLKIVGVGFKARAESEGRLLYLKLGYSHEVELTVPPAVRVFCFKPNIVCCTGI 276 MEAKFFRFLKIVGVG+KARAE+ GRLLYLKLGYSHEVEL VPPAVRVFCFK N++CCTGI Sbjct: 1 MEAKFFRFLKIVGVGYKARAEAAGRLLYLKLGYSHEVELAVPPAVRVFCFKNNVICCTGI 60 Query: 277 D 279 D Sbjct: 61 D 61 >ref|XP_006847191.1| hypothetical protein AMTR_s00017p00249300 [Amborella trichopoda] gi|548850220|gb|ERN08772.1| hypothetical protein AMTR_s00017p00249300 [Amborella trichopoda] Length = 104 Score = 117 bits (293), Expect = 2e-24 Identities = 54/61 (88%), Positives = 60/61 (98%) Frame = +1 Query: 94 NMEAKFFRFLKIVGVGFKARAESEGRLLYLKLGYSHEVELTVPPAVRVFCFKPNIVCCTG 273 ++EAK+FRFLKIVGVGFKARAE+ GR+L+LKLGYSHEVELTVPPAVRVFCFKPNIVCCTG Sbjct: 2 SIEAKYFRFLKIVGVGFKARAEAGGRMLFLKLGYSHEVELTVPPAVRVFCFKPNIVCCTG 61 Query: 274 I 276 I Sbjct: 62 I 62 >ref|XP_004300468.1| PREDICTED: 60S ribosomal protein L6, mitochondrial-like isoform 1 [Fragaria vesca subsp. vesca] gi|470129107|ref|XP_004300469.1| PREDICTED: 60S ribosomal protein L6, mitochondrial-like isoform 2 [Fragaria vesca subsp. vesca] Length = 102 Score = 117 bits (293), Expect = 2e-24 Identities = 53/61 (86%), Positives = 60/61 (98%) Frame = +1 Query: 97 MEAKFFRFLKIVGVGFKARAESEGRLLYLKLGYSHEVELTVPPAVRVFCFKPNIVCCTGI 276 MEA+FFRFLKIVGVG+KARAE++G++LYLKLGYSHEVELTVPPAVRVFCFK N+VCCTGI Sbjct: 1 MEAQFFRFLKIVGVGYKARAEAQGKMLYLKLGYSHEVELTVPPAVRVFCFKNNVVCCTGI 60 Query: 277 D 279 D Sbjct: 61 D 61 >gb|AFK46285.1| unknown [Medicago truncatula] Length = 102 Score = 117 bits (293), Expect = 2e-24 Identities = 54/61 (88%), Positives = 58/61 (95%) Frame = +1 Query: 97 MEAKFFRFLKIVGVGFKARAESEGRLLYLKLGYSHEVELTVPPAVRVFCFKPNIVCCTGI 276 MEAKFFRFLKIVGVG+KARAES GRLLYLKLGYSHEVEL+ PPAVRVFCFK N++CCTGI Sbjct: 1 MEAKFFRFLKIVGVGYKARAESAGRLLYLKLGYSHEVELSAPPAVRVFCFKNNVICCTGI 60 Query: 277 D 279 D Sbjct: 61 D 61 >ref|XP_003536284.1| PREDICTED: 60S ribosomal protein L6, mitochondrial-like [Glycine max] Length = 102 Score = 117 bits (293), Expect = 2e-24 Identities = 54/61 (88%), Positives = 58/61 (95%) Frame = +1 Query: 97 MEAKFFRFLKIVGVGFKARAESEGRLLYLKLGYSHEVELTVPPAVRVFCFKPNIVCCTGI 276 MEAKFFRFLKIVGVG+KARAE+ GRLLYLKLGYSHEVEL VPPAVRVFCFK N++CCTGI Sbjct: 1 MEAKFFRFLKIVGVGYKARAEAAGRLLYLKLGYSHEVELAVPPAVRVFCFKNNVICCTGI 60 Query: 277 D 279 D Sbjct: 61 D 61