BLASTX nr result
ID: Cocculus22_contig00028209
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00028209 (443 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME41807.1| hypothetical protein DOTSEDRAFT_74014 [Dothistrom... 62 8e-08 >gb|EME41807.1| hypothetical protein DOTSEDRAFT_74014 [Dothistroma septosporum NZE10] Length = 254 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -3 Query: 357 FELSEKEREAIATTAFYDRKSEGGIEDYLMQQQNQQPIIATC 232 FELS+KEREAI TTAFYD KS+ GIEDY+M Q QQP++A C Sbjct: 214 FELSDKEREAITTTAFYDIKSQQGIEDYIMSQP-QQPLVAPC 254