BLASTX nr result
ID: Cocculus22_contig00027350
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00027350 (399 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAK09334.1| alpha-glucan water dikinase [Nelumbo nucifera] 112 2e-24 ref|XP_006468768.1| PREDICTED: alpha-glucan water dikinase 2-lik... 103 6e-22 ref|XP_006468769.1| PREDICTED: alpha-glucan water dikinase 2-lik... 103 6e-22 ref|XP_006468770.1| PREDICTED: alpha-glucan water dikinase 2-lik... 103 6e-22 gb|AFO83530.1| glucan water dikinase 2 [Manihot esculenta] 103 7e-22 ref|XP_007227038.1| hypothetical protein PRUPE_ppa000345mg [Prun... 102 2e-21 ref|XP_006448371.1| hypothetical protein CICLE_v10017434mg [Citr... 102 2e-21 ref|XP_002315679.2| hypothetical protein POPTR_0010s05400g [Popu... 98 5e-20 ref|XP_002892597.1| hypothetical protein ARALYDRAFT_888368 [Arab... 98 5e-20 gb|AAF17665.1|AC009398_14 F20B24.19 [Arabidopsis thaliana] 97 6e-20 ref|NP_563877.1| alpha-glucan water dikinase 1 [Arabidopsis thal... 97 7e-20 gb|AAD31337.1|AC007354_10 Strong similarity to gb|Y09533 involve... 97 7e-20 ref|XP_006380009.1| hypothetical protein POPTR_0008s19230g [Popu... 97 7e-20 dbj|BAF02025.1| hypothetical protein [Arabidopsis thaliana] 97 7e-20 ref|XP_004135261.1| PREDICTED: alpha-glucan water dikinase, chlo... 97 8e-20 ref|XP_004164397.1| PREDICTED: LOW QUALITY PROTEIN: alpha-glucan... 97 8e-20 ref|XP_007227039.1| hypothetical protein PRUPE_ppa000209mg [Prun... 97 8e-20 gb|EXB82551.1| Alpha-glucan water dikinase [Morus notabilis] 97 8e-20 gb|AFO83529.1| glucan water dikinase 1 [Manihot esculenta] 97 8e-20 ref|XP_004298987.1| PREDICTED: alpha-glucan water dikinase 1, ch... 97 8e-20 >dbj|BAK09334.1| alpha-glucan water dikinase [Nelumbo nucifera] Length = 194 Score = 112 bits (280), Expect(2) = 2e-24 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = -1 Query: 270 SKWNERAYISCRKANLNHDHLCMAVLVQEVISADYAFVIHTRNPLSGDQSEIYAEV 103 SKWNERAYISCRKA+LNHDHLCMAVLVQE+ISADYAFVIHTRNPLSGD SEIY EV Sbjct: 3 SKWNERAYISCRKASLNHDHLCMAVLVQEIISADYAFVIHTRNPLSGDTSEIYTEV 58 Score = 25.4 bits (54), Expect(2) = 2e-24 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 38 QIVKGLGETLVG 3 ++VKGLGETLVG Sbjct: 57 EVVKGLGETLVG 68 >ref|XP_006468768.1| PREDICTED: alpha-glucan water dikinase 2-like isoform X1 [Citrus sinensis] Length = 1287 Score = 103 bits (258), Expect(2) = 6e-22 Identities = 46/56 (82%), Positives = 51/56 (91%) Frame = -1 Query: 270 SKWNERAYISCRKANLNHDHLCMAVLVQEVISADYAFVIHTRNPLSGDQSEIYAEV 103 SKWNERA+ISCRKANLNHD+LCMAVL+QE I DYAFVIHT+NPLSGD SEIY E+ Sbjct: 1096 SKWNERAFISCRKANLNHDNLCMAVLIQETICGDYAFVIHTKNPLSGDNSEIYTEI 1151 Score = 25.8 bits (55), Expect(2) = 6e-22 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = -2 Query: 38 QIVKGLGETLVG 3 +IVKGLGETLVG Sbjct: 1150 EIVKGLGETLVG 1161 >ref|XP_006468769.1| PREDICTED: alpha-glucan water dikinase 2-like isoform X2 [Citrus sinensis] Length = 1282 Score = 103 bits (258), Expect(2) = 6e-22 Identities = 46/56 (82%), Positives = 51/56 (91%) Frame = -1 Query: 270 SKWNERAYISCRKANLNHDHLCMAVLVQEVISADYAFVIHTRNPLSGDQSEIYAEV 103 SKWNERA+ISCRKANLNHD+LCMAVL+QE I DYAFVIHT+NPLSGD SEIY E+ Sbjct: 1091 SKWNERAFISCRKANLNHDNLCMAVLIQETICGDYAFVIHTKNPLSGDNSEIYTEI 1146 Score = 25.8 bits (55), Expect(2) = 6e-22 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = -2 Query: 38 QIVKGLGETLVG 3 +IVKGLGETLVG Sbjct: 1145 EIVKGLGETLVG 1156 >ref|XP_006468770.1| PREDICTED: alpha-glucan water dikinase 2-like isoform X3 [Citrus sinensis] Length = 1097 Score = 103 bits (258), Expect(2) = 6e-22 Identities = 46/56 (82%), Positives = 51/56 (91%) Frame = -1 Query: 270 SKWNERAYISCRKANLNHDHLCMAVLVQEVISADYAFVIHTRNPLSGDQSEIYAEV 103 SKWNERA+ISCRKANLNHD+LCMAVL+QE I DYAFVIHT+NPLSGD SEIY E+ Sbjct: 906 SKWNERAFISCRKANLNHDNLCMAVLIQETICGDYAFVIHTKNPLSGDNSEIYTEI 961 Score = 25.8 bits (55), Expect(2) = 6e-22 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = -2 Query: 38 QIVKGLGETLVG 3 +IVKGLGETLVG Sbjct: 960 EIVKGLGETLVG 971 >gb|AFO83530.1| glucan water dikinase 2 [Manihot esculenta] Length = 1228 Score = 103 bits (257), Expect(2) = 7e-22 Identities = 47/56 (83%), Positives = 52/56 (92%) Frame = -1 Query: 270 SKWNERAYISCRKANLNHDHLCMAVLVQEVISADYAFVIHTRNPLSGDQSEIYAEV 103 SKWNERAY+SCRKANLNHD+L MAVL+QEVIS DYAFVIHT+NPLSGD SEIY E+ Sbjct: 1037 SKWNERAYVSCRKANLNHDNLRMAVLIQEVISGDYAFVIHTKNPLSGDASEIYTEI 1092 Score = 25.8 bits (55), Expect(2) = 7e-22 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = -2 Query: 38 QIVKGLGETLVG 3 +IVKGLGETLVG Sbjct: 1091 EIVKGLGETLVG 1102 >ref|XP_007227038.1| hypothetical protein PRUPE_ppa000345mg [Prunus persica] gi|462423974|gb|EMJ28237.1| hypothetical protein PRUPE_ppa000345mg [Prunus persica] Length = 1262 Score = 102 bits (254), Expect(2) = 2e-21 Identities = 45/56 (80%), Positives = 53/56 (94%) Frame = -1 Query: 270 SKWNERAYISCRKANLNHDHLCMAVLVQEVISADYAFVIHTRNPLSGDQSEIYAEV 103 SKWNERA+ISCRKANL+H+++CMAVLVQE+I ADYAFVIHT+NPLSGD SEIY E+ Sbjct: 1071 SKWNERAFISCRKANLDHENICMAVLVQEIICADYAFVIHTKNPLSGDTSEIYTEI 1126 Score = 25.8 bits (55), Expect(2) = 2e-21 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = -2 Query: 38 QIVKGLGETLVG 3 +IVKGLGETLVG Sbjct: 1125 EIVKGLGETLVG 1136 >ref|XP_006448371.1| hypothetical protein CICLE_v10017434mg [Citrus clementina] gi|557550982|gb|ESR61611.1| hypothetical protein CICLE_v10017434mg [Citrus clementina] Length = 1244 Score = 102 bits (254), Expect(2) = 2e-21 Identities = 45/56 (80%), Positives = 51/56 (91%) Frame = -1 Query: 270 SKWNERAYISCRKANLNHDHLCMAVLVQEVISADYAFVIHTRNPLSGDQSEIYAEV 103 SKWNERA+ISCRKANLNHD+LCMAVL+QE I DYAFVIHT+NPLSGD SEI+ E+ Sbjct: 1053 SKWNERAFISCRKANLNHDNLCMAVLIQETICGDYAFVIHTKNPLSGDNSEIFTEI 1108 Score = 25.8 bits (55), Expect(2) = 2e-21 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = -2 Query: 38 QIVKGLGETLVG 3 +IVKGLGETLVG Sbjct: 1107 EIVKGLGETLVG 1118 >ref|XP_002315679.2| hypothetical protein POPTR_0010s05400g [Populus trichocarpa] gi|550329131|gb|EEF01850.2| hypothetical protein POPTR_0010s05400g [Populus trichocarpa] Length = 1476 Score = 97.8 bits (242), Expect(2) = 5e-20 Identities = 46/56 (82%), Positives = 49/56 (87%) Frame = -1 Query: 270 SKWNERAYISCRKANLNHDHLCMAVLVQEVISADYAFVIHTRNPLSGDQSEIYAEV 103 SKWNERAY S RK L+HD+LCMAVLVQEVI+ADYAFVIHT NP SGD SEIYAEV Sbjct: 1285 SKWNERAYFSARKVKLDHDYLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYAEV 1340 Score = 25.4 bits (54), Expect(2) = 5e-20 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 38 QIVKGLGETLVG 3 ++VKGLGETLVG Sbjct: 1339 EVVKGLGETLVG 1350 >ref|XP_002892597.1| hypothetical protein ARALYDRAFT_888368 [Arabidopsis lyrata subsp. lyrata] gi|297338439|gb|EFH68856.1| hypothetical protein ARALYDRAFT_888368 [Arabidopsis lyrata subsp. lyrata] Length = 1396 Score = 97.8 bits (242), Expect(2) = 5e-20 Identities = 46/56 (82%), Positives = 49/56 (87%) Frame = -1 Query: 270 SKWNERAYISCRKANLNHDHLCMAVLVQEVISADYAFVIHTRNPLSGDQSEIYAEV 103 SKWNERAY S RK L+HD+LCMAVLVQEVI+ADYAFVIHT NP SGD SEIYAEV Sbjct: 1205 SKWNERAYFSARKVKLDHDYLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYAEV 1260 Score = 25.4 bits (54), Expect(2) = 5e-20 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 38 QIVKGLGETLVG 3 ++VKGLGETLVG Sbjct: 1259 EVVKGLGETLVG 1270 >gb|AAF17665.1|AC009398_14 F20B24.19 [Arabidopsis thaliana] Length = 1540 Score = 97.4 bits (241), Expect(2) = 6e-20 Identities = 46/56 (82%), Positives = 49/56 (87%) Frame = -1 Query: 270 SKWNERAYISCRKANLNHDHLCMAVLVQEVISADYAFVIHTRNPLSGDQSEIYAEV 103 SKWNERAY S RK L+HD+LCMAVLVQEVI+ADYAFVIHT NP SGD SEIYAEV Sbjct: 1349 SKWNERAYFSTRKVKLDHDYLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYAEV 1404 Score = 25.4 bits (54), Expect(2) = 6e-20 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 38 QIVKGLGETLVG 3 ++VKGLGETLVG Sbjct: 1403 EVVKGLGETLVG 1414 >ref|NP_563877.1| alpha-glucan water dikinase 1 [Arabidopsis thaliana] gi|57012990|sp|Q9SAC6.2|GWD1_ARATH RecName: Full=Alpha-glucan water dikinase 1, chloroplastic; AltName: Full=Protein starch excess 1; AltName: Full=Protein starch-related R1; Flags: Precursor gi|12044358|gb|AAG47821.1|AF312027_1 SEX1 [Arabidopsis thaliana] gi|332190522|gb|AEE28643.1| alpha-glucan water dikinase 1 [Arabidopsis thaliana] Length = 1399 Score = 97.4 bits (241), Expect(2) = 7e-20 Identities = 46/56 (82%), Positives = 49/56 (87%) Frame = -1 Query: 270 SKWNERAYISCRKANLNHDHLCMAVLVQEVISADYAFVIHTRNPLSGDQSEIYAEV 103 SKWNERAY S RK L+HD+LCMAVLVQEVI+ADYAFVIHT NP SGD SEIYAEV Sbjct: 1208 SKWNERAYFSTRKVKLDHDYLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYAEV 1263 Score = 25.4 bits (54), Expect(2) = 7e-20 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 38 QIVKGLGETLVG 3 ++VKGLGETLVG Sbjct: 1262 EVVKGLGETLVG 1273 >gb|AAD31337.1|AC007354_10 Strong similarity to gb|Y09533 involved in starch metabolism from Solanum tuberosum and contains a PF|01326 Pyruvate phosphate dikinase, PEP/pyruvate binding domain. EST gb|N96757 comes from this gene [Arabidopsis thaliana] Length = 1358 Score = 97.4 bits (241), Expect(2) = 7e-20 Identities = 46/56 (82%), Positives = 49/56 (87%) Frame = -1 Query: 270 SKWNERAYISCRKANLNHDHLCMAVLVQEVISADYAFVIHTRNPLSGDQSEIYAEV 103 SKWNERAY S RK L+HD+LCMAVLVQEVI+ADYAFVIHT NP SGD SEIYAEV Sbjct: 1167 SKWNERAYFSTRKVKLDHDYLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYAEV 1222 Score = 25.4 bits (54), Expect(2) = 7e-20 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 38 QIVKGLGETLVG 3 ++VKGLGETLVG Sbjct: 1221 EVVKGLGETLVG 1232 >ref|XP_006380009.1| hypothetical protein POPTR_0008s19230g [Populus trichocarpa] gi|550333451|gb|ERP57806.1| hypothetical protein POPTR_0008s19230g [Populus trichocarpa] Length = 877 Score = 97.4 bits (241), Expect(2) = 7e-20 Identities = 46/56 (82%), Positives = 49/56 (87%) Frame = -1 Query: 270 SKWNERAYISCRKANLNHDHLCMAVLVQEVISADYAFVIHTRNPLSGDQSEIYAEV 103 SKWNERAY S RK L+HD+LCMAVLVQEVI+ADYAFVIHT NP SGD SEIYAEV Sbjct: 686 SKWNERAYFSTRKVKLDHDYLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYAEV 741 Score = 25.4 bits (54), Expect(2) = 7e-20 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 38 QIVKGLGETLVG 3 ++VKGLGETLVG Sbjct: 740 EVVKGLGETLVG 751 >dbj|BAF02025.1| hypothetical protein [Arabidopsis thaliana] Length = 789 Score = 97.4 bits (241), Expect(2) = 7e-20 Identities = 46/56 (82%), Positives = 49/56 (87%) Frame = -1 Query: 270 SKWNERAYISCRKANLNHDHLCMAVLVQEVISADYAFVIHTRNPLSGDQSEIYAEV 103 SKWNERAY S RK L+HD+LCMAVLVQEVI+ADYAFVIHT NP SGD SEIYAEV Sbjct: 598 SKWNERAYFSTRKVKLDHDYLCMAVLVQEVINADYAFVIHTTNPSSGDSSEIYAEV 653 Score = 25.4 bits (54), Expect(2) = 7e-20 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 38 QIVKGLGETLVG 3 ++VKGLGETLVG Sbjct: 652 EVVKGLGETLVG 663 >ref|XP_004135261.1| PREDICTED: alpha-glucan water dikinase, chloroplastic-like [Cucumis sativus] Length = 1482 Score = 97.1 bits (240), Expect(2) = 8e-20 Identities = 45/56 (80%), Positives = 49/56 (87%) Frame = -1 Query: 270 SKWNERAYISCRKANLNHDHLCMAVLVQEVISADYAFVIHTRNPLSGDQSEIYAEV 103 SKWNERAY S RK L+HD+LCMAVLVQE+I+ADYAFVIHT NP SGD SEIYAEV Sbjct: 1291 SKWNERAYFSTRKVKLDHDYLCMAVLVQEIINADYAFVIHTTNPSSGDSSEIYAEV 1346 Score = 25.4 bits (54), Expect(2) = 8e-20 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 38 QIVKGLGETLVG 3 ++VKGLGETLVG Sbjct: 1345 EVVKGLGETLVG 1356 >ref|XP_004164397.1| PREDICTED: LOW QUALITY PROTEIN: alpha-glucan water dikinase, chloroplastic-like, partial [Cucumis sativus] Length = 1471 Score = 97.1 bits (240), Expect(2) = 8e-20 Identities = 45/56 (80%), Positives = 49/56 (87%) Frame = -1 Query: 270 SKWNERAYISCRKANLNHDHLCMAVLVQEVISADYAFVIHTRNPLSGDQSEIYAEV 103 SKWNERAY S RK L+HD+LCMAVLVQE+I+ADYAFVIHT NP SGD SEIYAEV Sbjct: 1290 SKWNERAYFSTRKVKLDHDYLCMAVLVQEIINADYAFVIHTTNPSSGDSSEIYAEV 1345 Score = 25.4 bits (54), Expect(2) = 8e-20 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 38 QIVKGLGETLVG 3 ++VKGLGETLVG Sbjct: 1344 EVVKGLGETLVG 1355 >ref|XP_007227039.1| hypothetical protein PRUPE_ppa000209mg [Prunus persica] gi|462423975|gb|EMJ28238.1| hypothetical protein PRUPE_ppa000209mg [Prunus persica] Length = 1467 Score = 97.1 bits (240), Expect(2) = 8e-20 Identities = 45/56 (80%), Positives = 49/56 (87%) Frame = -1 Query: 270 SKWNERAYISCRKANLNHDHLCMAVLVQEVISADYAFVIHTRNPLSGDQSEIYAEV 103 SKWNERAY S RK L+HD+LCMAVLVQE+I+ADYAFVIHT NP SGD SEIYAEV Sbjct: 1276 SKWNERAYFSTRKVKLDHDYLCMAVLVQEIINADYAFVIHTTNPSSGDSSEIYAEV 1331 Score = 25.4 bits (54), Expect(2) = 8e-20 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 38 QIVKGLGETLVG 3 ++VKGLGETLVG Sbjct: 1330 EVVKGLGETLVG 1341 >gb|EXB82551.1| Alpha-glucan water dikinase [Morus notabilis] Length = 1436 Score = 97.1 bits (240), Expect(2) = 8e-20 Identities = 45/56 (80%), Positives = 49/56 (87%) Frame = -1 Query: 270 SKWNERAYISCRKANLNHDHLCMAVLVQEVISADYAFVIHTRNPLSGDQSEIYAEV 103 SKWNERAY S RK L+HD+LCMAVLVQE+I+ADYAFVIHT NP SGD SEIYAEV Sbjct: 1269 SKWNERAYFSTRKVKLDHDYLCMAVLVQEIINADYAFVIHTTNPSSGDDSEIYAEV 1324 Score = 25.4 bits (54), Expect(2) = 8e-20 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 38 QIVKGLGETLVG 3 ++VKGLGETLVG Sbjct: 1323 EVVKGLGETLVG 1334 >gb|AFO83529.1| glucan water dikinase 1 [Manihot esculenta] Length = 1409 Score = 97.1 bits (240), Expect(2) = 8e-20 Identities = 45/56 (80%), Positives = 49/56 (87%) Frame = -1 Query: 270 SKWNERAYISCRKANLNHDHLCMAVLVQEVISADYAFVIHTRNPLSGDQSEIYAEV 103 SKWNERAY S RK L+HD+LCMAVLVQE+I+ADYAFVIHT NP SGD SEIYAEV Sbjct: 1218 SKWNERAYFSTRKVKLDHDYLCMAVLVQEIINADYAFVIHTTNPSSGDSSEIYAEV 1273 Score = 25.4 bits (54), Expect(2) = 8e-20 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 38 QIVKGLGETLVG 3 ++VKGLGETLVG Sbjct: 1272 EVVKGLGETLVG 1283 >ref|XP_004298987.1| PREDICTED: alpha-glucan water dikinase 1, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 1401 Score = 97.1 bits (240), Expect(2) = 8e-20 Identities = 45/56 (80%), Positives = 49/56 (87%) Frame = -1 Query: 270 SKWNERAYISCRKANLNHDHLCMAVLVQEVISADYAFVIHTRNPLSGDQSEIYAEV 103 SKWNERAY S RK L+HD+LCMAVLVQE+I+ADYAFVIHT NP SGD SEIYAEV Sbjct: 1210 SKWNERAYFSTRKVKLDHDYLCMAVLVQEIINADYAFVIHTTNPSSGDSSEIYAEV 1265 Score = 25.4 bits (54), Expect(2) = 8e-20 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 38 QIVKGLGETLVG 3 ++VKGLGETLVG Sbjct: 1264 EVVKGLGETLVG 1275