BLASTX nr result
ID: Cocculus22_contig00027316
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00027316 (308 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001275477.1| nitric oxide synthase-associated protein I [... 55 8e-06 >ref|NP_001275477.1| nitric oxide synthase-associated protein I [Solanum tuberosum] gi|290793111|gb|ADD63989.1| nitric oxide synthase-associated protein I [Solanum tuberosum] Length = 561 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/52 (48%), Positives = 36/52 (69%) Frame = +3 Query: 144 SPKPSIVFCKSTDSQTQSQEFSSPNLTVSSEELDGFGAAAPTRGDVFLSRQK 299 +PKP+++FCKST+ QT +S E +G+GAAAPTRGD++L RQ+ Sbjct: 34 TPKPTLIFCKSTEPQT-----------ISESEPEGYGAAAPTRGDIYLQRQQ 74