BLASTX nr result
ID: Cocculus22_contig00027200
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00027200 (317 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ53192.1| JHL03K20.1 [Jatropha curcas] 64 2e-08 emb|CBI21389.3| unnamed protein product [Vitis vinifera] 63 5e-08 ref|XP_002278347.1| PREDICTED: OTU domain-containing protein 3-l... 63 5e-08 emb|CAN65606.1| hypothetical protein VITISV_042268 [Vitis vinifera] 63 5e-08 ref|XP_006361739.1| PREDICTED: OTU domain-containing protein 3-l... 62 8e-08 ref|XP_006361737.1| PREDICTED: OTU domain-containing protein 3-l... 62 8e-08 gb|EXC24726.1| hypothetical protein L484_005775 [Morus notabilis] 60 2e-07 ref|XP_002523634.1| OTU domain-containing protein, putative [Ric... 60 2e-07 ref|XP_004234665.1| PREDICTED: OTU domain-containing protein 3-l... 60 3e-07 ref|XP_004509124.1| PREDICTED: OTU domain-containing protein 3-l... 58 2e-06 ref|XP_004509118.1| PREDICTED: OTU domain-containing protein 3-l... 58 2e-06 ref|XP_006383527.1| hypothetical protein POPTR_0005s18390g [Popu... 57 2e-06 ref|XP_002306480.1| hypothetical protein POPTR_0005s18390g [Popu... 57 2e-06 ref|XP_007155906.1| hypothetical protein PHAVU_003G242000g [Phas... 56 4e-06 ref|XP_006850514.1| hypothetical protein AMTR_s00035p00239450 [A... 56 4e-06 ref|XP_006280643.1| hypothetical protein CARUB_v10026604mg [Caps... 56 4e-06 tpg|DAA35445.1| TPA: hypothetical protein ZEAMMB73_644810 [Zea m... 56 4e-06 >dbj|BAJ53192.1| JHL03K20.1 [Jatropha curcas] Length = 397 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -2 Query: 196 VKKRGKQTDIAEFRSQLDALGLKIVQVTADGNC 98 VKKRGKQTDI +FR+QLDALGLKI+QVTADGNC Sbjct: 18 VKKRGKQTDITQFRAQLDALGLKIIQVTADGNC 50 >emb|CBI21389.3| unnamed protein product [Vitis vinifera] Length = 385 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -2 Query: 199 QVKKRGKQTDIAEFRSQLDALGLKIVQVTADGNC 98 Q+KK+GKQ DI+EFR+QLDALGLKI+QVTADGNC Sbjct: 17 QMKKQGKQADISEFRAQLDALGLKIIQVTADGNC 50 >ref|XP_002278347.1| PREDICTED: OTU domain-containing protein 3-like [Vitis vinifera] Length = 467 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -2 Query: 199 QVKKRGKQTDIAEFRSQLDALGLKIVQVTADGNC 98 Q+KK+GKQ DI+EFR+QLDALGLKI+QVTADGNC Sbjct: 17 QMKKQGKQADISEFRAQLDALGLKIIQVTADGNC 50 >emb|CAN65606.1| hypothetical protein VITISV_042268 [Vitis vinifera] Length = 1324 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -2 Query: 199 QVKKRGKQTDIAEFRSQLDALGLKIVQVTADGNC 98 Q+KK+GKQ DI+EFR+QLDALGLKI+QVTADGNC Sbjct: 17 QMKKQGKQADISEFRAQLDALGLKIIQVTADGNC 50 >ref|XP_006361739.1| PREDICTED: OTU domain-containing protein 3-like isoform X3 [Solanum tuberosum] Length = 375 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 193 KKRGKQTDIAEFRSQLDALGLKIVQVTADGNC 98 KK GKQTDI+EFR+QLDALGLKI+QVTADGNC Sbjct: 18 KKHGKQTDISEFRAQLDALGLKIIQVTADGNC 49 >ref|XP_006361737.1| PREDICTED: OTU domain-containing protein 3-like isoform X1 [Solanum tuberosum] gi|565392085|ref|XP_006361738.1| PREDICTED: OTU domain-containing protein 3-like isoform X2 [Solanum tuberosum] Length = 378 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 193 KKRGKQTDIAEFRSQLDALGLKIVQVTADGNC 98 KK GKQTDI+EFR+QLDALGLKI+QVTADGNC Sbjct: 18 KKHGKQTDISEFRAQLDALGLKIIQVTADGNC 49 >gb|EXC24726.1| hypothetical protein L484_005775 [Morus notabilis] Length = 403 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -2 Query: 196 VKKRGKQTDIAEFRSQLDALGLKIVQVTADGNC 98 +KK+GKQ DI++FR+QLDALGLKI+QVTADGNC Sbjct: 40 IKKQGKQADISQFRAQLDALGLKIIQVTADGNC 72 >ref|XP_002523634.1| OTU domain-containing protein, putative [Ricinus communis] gi|223537196|gb|EEF38829.1| OTU domain-containing protein, putative [Ricinus communis] Length = 371 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -2 Query: 196 VKKRGKQTDIAEFRSQLDALGLKIVQVTADGNC 98 VKK+GKQ DI +FR+QLDALGLKI+QVTADGNC Sbjct: 18 VKKQGKQADITQFRAQLDALGLKIIQVTADGNC 50 >ref|XP_004234665.1| PREDICTED: OTU domain-containing protein 3-like [Solanum lycopersicum] Length = 378 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 193 KKRGKQTDIAEFRSQLDALGLKIVQVTADGNC 98 KK GKQ DI+EFR+QLDALGLKI+QVTADGNC Sbjct: 18 KKHGKQADISEFRAQLDALGLKIIQVTADGNC 49 >ref|XP_004509124.1| PREDICTED: OTU domain-containing protein 3-like isoform X7 [Cicer arietinum] Length = 314 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = -2 Query: 199 QVKKRGKQTDIAEFRSQLDALGLKIVQVTADGNC 98 Q+KK+GKQ D ++FR+QLDALGL+IV+VTADGNC Sbjct: 19 QIKKQGKQDDSSQFRTQLDALGLRIVEVTADGNC 52 >ref|XP_004509118.1| PREDICTED: OTU domain-containing protein 3-like isoform X1 [Cicer arietinum] gi|502152840|ref|XP_004509119.1| PREDICTED: OTU domain-containing protein 3-like isoform X2 [Cicer arietinum] gi|502152842|ref|XP_004509120.1| PREDICTED: OTU domain-containing protein 3-like isoform X3 [Cicer arietinum] gi|502152844|ref|XP_004509121.1| PREDICTED: OTU domain-containing protein 3-like isoform X4 [Cicer arietinum] gi|502152846|ref|XP_004509122.1| PREDICTED: OTU domain-containing protein 3-like isoform X5 [Cicer arietinum] gi|502152848|ref|XP_004509123.1| PREDICTED: OTU domain-containing protein 3-like isoform X6 [Cicer arietinum] Length = 377 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = -2 Query: 199 QVKKRGKQTDIAEFRSQLDALGLKIVQVTADGNC 98 Q+KK+GKQ D ++FR+QLDALGL+IV+VTADGNC Sbjct: 19 QIKKQGKQDDSSQFRTQLDALGLRIVEVTADGNC 52 >ref|XP_006383527.1| hypothetical protein POPTR_0005s18390g [Populus trichocarpa] gi|550339234|gb|ERP61324.1| hypothetical protein POPTR_0005s18390g [Populus trichocarpa] Length = 317 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -2 Query: 196 VKKRGKQTDIAEFRSQLDALGLKIVQVTADGNC 98 VKK+GKQ +I +FR+QLDALGLKI++VTADGNC Sbjct: 17 VKKQGKQANIVQFRAQLDALGLKIIEVTADGNC 49 >ref|XP_002306480.1| hypothetical protein POPTR_0005s18390g [Populus trichocarpa] gi|222855929|gb|EEE93476.1| hypothetical protein POPTR_0005s18390g [Populus trichocarpa] Length = 349 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -2 Query: 196 VKKRGKQTDIAEFRSQLDALGLKIVQVTADGNC 98 VKK+GKQ +I +FR+QLDALGLKI++VTADGNC Sbjct: 17 VKKQGKQANIVQFRAQLDALGLKIIEVTADGNC 49 >ref|XP_007155906.1| hypothetical protein PHAVU_003G242000g [Phaseolus vulgaris] gi|561029260|gb|ESW27900.1| hypothetical protein PHAVU_003G242000g [Phaseolus vulgaris] Length = 383 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -2 Query: 199 QVKKRGKQTDIAEFRSQLDALGLKIVQVTADGNC 98 QVKK GK+ D ++FR+QLDALGL+IV+VTADGNC Sbjct: 19 QVKKLGKRADTSQFRTQLDALGLRIVEVTADGNC 52 >ref|XP_006850514.1| hypothetical protein AMTR_s00035p00239450 [Amborella trichopoda] gi|548854160|gb|ERN12095.1| hypothetical protein AMTR_s00035p00239450 [Amborella trichopoda] Length = 385 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -2 Query: 196 VKKRGKQTDIAEFRSQLDALGLKIVQVTADGNCL 95 V K GK TD+ F+SQLDALGLKI+QVT+DGNCL Sbjct: 19 VVKHGKHTDLTHFKSQLDALGLKIIQVTSDGNCL 52 >ref|XP_006280643.1| hypothetical protein CARUB_v10026604mg [Capsella rubella] gi|482549347|gb|EOA13541.1| hypothetical protein CARUB_v10026604mg [Capsella rubella] Length = 376 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/35 (68%), Positives = 32/35 (91%) Frame = -2 Query: 202 VQVKKRGKQTDIAEFRSQLDALGLKIVQVTADGNC 98 V+ KK+GK D+++FR+QLDALGLKI+QVT+DGNC Sbjct: 18 VKKKKQGKDCDLSQFRAQLDALGLKIIQVTSDGNC 52 >tpg|DAA35445.1| TPA: hypothetical protein ZEAMMB73_644810 [Zea mays] Length = 391 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -2 Query: 193 KKRGKQTDIAEFRSQLDALGLKIVQVTADGNC 98 KK GK+ D+AEFR+QLD+LGLKIVQVTADGNC Sbjct: 24 KKLGKKGDMAEFRAQLDSLGLKIVQVTADGNC 55