BLASTX nr result
ID: Cocculus22_contig00027189
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00027189 (369 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006856262.1| hypothetical protein AMTR_s00047p00057940 [A... 124 1e-26 >ref|XP_006856262.1| hypothetical protein AMTR_s00047p00057940 [Amborella trichopoda] gi|548860122|gb|ERN17729.1| hypothetical protein AMTR_s00047p00057940 [Amborella trichopoda] Length = 180 Score = 124 bits (311), Expect = 1e-26 Identities = 64/71 (90%), Positives = 64/71 (90%) Frame = +1 Query: 40 MEK*KLGSLPEVTGFGALHLLAQALARDFKWLGASLVAGRLEIVIDHKRFQLSRSFYDKA 219 MEK KLGSLPEV GFG LHLLAQALARD KWLG SLVA RLEIVIDHKRFQLSRSFYDKA Sbjct: 1 MEKSKLGSLPEVMGFGTLHLLAQALARDCKWLGDSLVAERLEIVIDHKRFQLSRSFYDKA 60 Query: 220 WAGLLRRLGFS 252 WAGLLRRL FS Sbjct: 61 WAGLLRRLVFS 71