BLASTX nr result
ID: Cocculus22_contig00026973
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00026973 (390 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007160608.1| hypothetical protein PHAVU_001G001600g [Phas... 114 1e-23 ref|XP_003544381.1| PREDICTED: putative tRNA pseudouridine synth... 114 1e-23 emb|CBI18893.3| unnamed protein product [Vitis vinifera] 114 1e-23 ref|XP_002284814.1| PREDICTED: putative tRNA pseudouridine synth... 114 1e-23 gb|EYU36817.1| hypothetical protein MIMGU_mgv1a003989mg [Mimulus... 114 2e-23 gb|EYU36816.1| hypothetical protein MIMGU_mgv1a003989mg [Mimulus... 114 2e-23 ref|XP_002307763.2| hypothetical protein POPTR_0005s26880g [Popu... 113 2e-23 ref|XP_006838680.1| hypothetical protein AMTR_s00002p00244810 [A... 113 2e-23 gb|EXB88230.1| hypothetical protein L484_011660 [Morus notabilis] 113 3e-23 ref|XP_007017946.1| Pseudouridine synthase family protein, putat... 113 3e-23 ref|XP_002510624.1| conserved hypothetical protein [Ricinus comm... 113 3e-23 ref|XP_006473742.1| PREDICTED: putative tRNA pseudouridine synth... 111 1e-22 ref|XP_006435288.1| hypothetical protein CICLE_v10000742mg [Citr... 111 1e-22 ref|XP_006435287.1| hypothetical protein CICLE_v10000742mg [Citr... 111 1e-22 ref|XP_004499319.1| PREDICTED: putative tRNA pseudouridine synth... 111 1e-22 ref|XP_006342101.1| PREDICTED: putative tRNA pseudouridine synth... 110 2e-22 ref|XP_004238405.1| PREDICTED: putative tRNA pseudouridine synth... 108 1e-21 ref|XP_004172989.1| PREDICTED: putative tRNA pseudouridine synth... 108 1e-21 ref|XP_004145592.1| PREDICTED: putative tRNA pseudouridine synth... 108 1e-21 gb|ADN34134.1| hypothetical protein [Cucumis melo subsp. melo] 108 1e-21 >ref|XP_007160608.1| hypothetical protein PHAVU_001G001600g [Phaseolus vulgaris] gi|561034072|gb|ESW32602.1| hypothetical protein PHAVU_001G001600g [Phaseolus vulgaris] Length = 503 Score = 114 bits (286), Expect = 1e-23 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +1 Query: 1 GNSQYFQLHLCTQAGTYIKEFVHGDLGRTHPSIGSILGCRAEILQLDVTDVKMDCF 168 G+SQYF LHLCTQAGTYIKEFVHGDLGRTHPSIGSILGCRAEILQLDVTD+KM+CF Sbjct: 446 GSSQYFLLHLCTQAGTYIKEFVHGDLGRTHPSIGSILGCRAEILQLDVTDIKMECF 501 >ref|XP_003544381.1| PREDICTED: putative tRNA pseudouridine synthase Pus10-like [Glycine max] Length = 484 Score = 114 bits (286), Expect = 1e-23 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +1 Query: 1 GNSQYFQLHLCTQAGTYIKEFVHGDLGRTHPSIGSILGCRAEILQLDVTDVKMDCF 168 G+SQYF LHLCTQAGTYIKEFVHGDLGRTHPSIGSILGCRAEILQLDVTD+KM+CF Sbjct: 427 GSSQYFLLHLCTQAGTYIKEFVHGDLGRTHPSIGSILGCRAEILQLDVTDIKMECF 482 >emb|CBI18893.3| unnamed protein product [Vitis vinifera] Length = 591 Score = 114 bits (286), Expect = 1e-23 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +1 Query: 1 GNSQYFQLHLCTQAGTYIKEFVHGDLGRTHPSIGSILGCRAEILQLDVTDVKMDCF 168 G+SQYF LHLCTQAGTYIKEFVHGDLGRTHPS+GSILGCRAEILQLDVT+VKMDCF Sbjct: 533 GSSQYFLLHLCTQAGTYIKEFVHGDLGRTHPSVGSILGCRAEILQLDVTEVKMDCF 588 >ref|XP_002284814.1| PREDICTED: putative tRNA pseudouridine synthase Pus10-like [Vitis vinifera] Length = 578 Score = 114 bits (286), Expect = 1e-23 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +1 Query: 1 GNSQYFQLHLCTQAGTYIKEFVHGDLGRTHPSIGSILGCRAEILQLDVTDVKMDCF 168 G+SQYF LHLCTQAGTYIKEFVHGDLGRTHPS+GSILGCRAEILQLDVT+VKMDCF Sbjct: 520 GSSQYFLLHLCTQAGTYIKEFVHGDLGRTHPSVGSILGCRAEILQLDVTEVKMDCF 575 >gb|EYU36817.1| hypothetical protein MIMGU_mgv1a003989mg [Mimulus guttatus] Length = 539 Score = 114 bits (284), Expect = 2e-23 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = +1 Query: 1 GNSQYFQLHLCTQAGTYIKEFVHGDLGRTHPSIGSILGCRAEILQLDVTDVKMDCF 168 G+SQYF LHLCTQAGTYIKEFVHGDLGRT PS+GSILGCRAEILQLDVTDVKMDCF Sbjct: 482 GSSQYFMLHLCTQAGTYIKEFVHGDLGRTQPSVGSILGCRAEILQLDVTDVKMDCF 537 >gb|EYU36816.1| hypothetical protein MIMGU_mgv1a003989mg [Mimulus guttatus] Length = 551 Score = 114 bits (284), Expect = 2e-23 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = +1 Query: 1 GNSQYFQLHLCTQAGTYIKEFVHGDLGRTHPSIGSILGCRAEILQLDVTDVKMDCF 168 G+SQYF LHLCTQAGTYIKEFVHGDLGRT PS+GSILGCRAEILQLDVTDVKMDCF Sbjct: 482 GSSQYFMLHLCTQAGTYIKEFVHGDLGRTQPSVGSILGCRAEILQLDVTDVKMDCF 537 >ref|XP_002307763.2| hypothetical protein POPTR_0005s26880g [Populus trichocarpa] gi|550339817|gb|EEE94759.2| hypothetical protein POPTR_0005s26880g [Populus trichocarpa] Length = 520 Score = 113 bits (283), Expect = 2e-23 Identities = 53/56 (94%), Positives = 54/56 (96%) Frame = +1 Query: 1 GNSQYFQLHLCTQAGTYIKEFVHGDLGRTHPSIGSILGCRAEILQLDVTDVKMDCF 168 G+SQYF LHLCTQAGTYIKEFVHGDLGRTHPSIGSIL CRAEILQLDVTDVKMDCF Sbjct: 462 GSSQYFLLHLCTQAGTYIKEFVHGDLGRTHPSIGSILRCRAEILQLDVTDVKMDCF 517 >ref|XP_006838680.1| hypothetical protein AMTR_s00002p00244810 [Amborella trichopoda] gi|548841186|gb|ERN01249.1| hypothetical protein AMTR_s00002p00244810 [Amborella trichopoda] Length = 526 Score = 113 bits (283), Expect = 2e-23 Identities = 51/57 (89%), Positives = 55/57 (96%) Frame = +1 Query: 1 GNSQYFQLHLCTQAGTYIKEFVHGDLGRTHPSIGSILGCRAEILQLDVTDVKMDCFN 171 G+ Q+F LHLCTQAGTYIKEFVHGDLGRTHP++GSILGCRAEILQLDVTDVKMDCFN Sbjct: 469 GSKQFFILHLCTQAGTYIKEFVHGDLGRTHPNLGSILGCRAEILQLDVTDVKMDCFN 525 >gb|EXB88230.1| hypothetical protein L484_011660 [Morus notabilis] Length = 514 Score = 113 bits (282), Expect = 3e-23 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = +1 Query: 1 GNSQYFQLHLCTQAGTYIKEFVHGDLGRTHPSIGSILGCRAEILQLDVTDVKMDCF 168 G+SQYF LHLCTQAGTYIKEFVHGDLGRT+PSIG+ILGCRAEILQLDVTDVKMDCF Sbjct: 459 GSSQYFLLHLCTQAGTYIKEFVHGDLGRTYPSIGTILGCRAEILQLDVTDVKMDCF 514 >ref|XP_007017946.1| Pseudouridine synthase family protein, putative isoform 1 [Theobroma cacao] gi|508723274|gb|EOY15171.1| Pseudouridine synthase family protein, putative isoform 1 [Theobroma cacao] Length = 548 Score = 113 bits (282), Expect = 3e-23 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = +1 Query: 1 GNSQYFQLHLCTQAGTYIKEFVHGDLGRTHPSIGSILGCRAEILQLDVTDVKMDCF 168 G+SQYF LHLCTQAGTYIKEFVHGDLGRT PS+GSILGCRAEILQLDVTDVKMDCF Sbjct: 490 GSSQYFLLHLCTQAGTYIKEFVHGDLGRTQPSVGSILGCRAEILQLDVTDVKMDCF 545 >ref|XP_002510624.1| conserved hypothetical protein [Ricinus communis] gi|223551325|gb|EEF52811.1| conserved hypothetical protein [Ricinus communis] Length = 565 Score = 113 bits (282), Expect = 3e-23 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = +1 Query: 1 GNSQYFQLHLCTQAGTYIKEFVHGDLGRTHPSIGSILGCRAEILQLDVTDVKMDCF 168 G+ QYF LHLCTQAGTYIKEFVHGDLGRTHPSIGSILGCRAEILQLDVT+VKMDCF Sbjct: 507 GSCQYFLLHLCTQAGTYIKEFVHGDLGRTHPSIGSILGCRAEILQLDVTEVKMDCF 562 >ref|XP_006473742.1| PREDICTED: putative tRNA pseudouridine synthase Pus10-like isoform X1 [Citrus sinensis] Length = 561 Score = 111 bits (277), Expect = 1e-22 Identities = 51/56 (91%), Positives = 55/56 (98%) Frame = +1 Query: 1 GNSQYFQLHLCTQAGTYIKEFVHGDLGRTHPSIGSILGCRAEILQLDVTDVKMDCF 168 G+SQYF LH+CTQAGTYIKEFVHGDLGRT+PSIGSILGCRAEILQLDVTDVKM+CF Sbjct: 503 GSSQYFLLHMCTQAGTYIKEFVHGDLGRTNPSIGSILGCRAEILQLDVTDVKMNCF 558 >ref|XP_006435288.1| hypothetical protein CICLE_v10000742mg [Citrus clementina] gi|557537410|gb|ESR48528.1| hypothetical protein CICLE_v10000742mg [Citrus clementina] Length = 355 Score = 111 bits (277), Expect = 1e-22 Identities = 51/56 (91%), Positives = 55/56 (98%) Frame = +1 Query: 1 GNSQYFQLHLCTQAGTYIKEFVHGDLGRTHPSIGSILGCRAEILQLDVTDVKMDCF 168 G+SQYF LH+CTQAGTYIKEFVHGDLGRT+PSIGSILGCRAEILQLDVTDVKM+CF Sbjct: 297 GSSQYFLLHMCTQAGTYIKEFVHGDLGRTNPSIGSILGCRAEILQLDVTDVKMNCF 352 >ref|XP_006435287.1| hypothetical protein CICLE_v10000742mg [Citrus clementina] gi|568839548|ref|XP_006473743.1| PREDICTED: putative tRNA pseudouridine synthase Pus10-like isoform X2 [Citrus sinensis] gi|557537409|gb|ESR48527.1| hypothetical protein CICLE_v10000742mg [Citrus clementina] Length = 557 Score = 111 bits (277), Expect = 1e-22 Identities = 51/56 (91%), Positives = 55/56 (98%) Frame = +1 Query: 1 GNSQYFQLHLCTQAGTYIKEFVHGDLGRTHPSIGSILGCRAEILQLDVTDVKMDCF 168 G+SQYF LH+CTQAGTYIKEFVHGDLGRT+PSIGSILGCRAEILQLDVTDVKM+CF Sbjct: 499 GSSQYFLLHMCTQAGTYIKEFVHGDLGRTNPSIGSILGCRAEILQLDVTDVKMNCF 554 >ref|XP_004499319.1| PREDICTED: putative tRNA pseudouridine synthase Pus10-like isoform X1 [Cicer arietinum] gi|502126472|ref|XP_004499320.1| PREDICTED: putative tRNA pseudouridine synthase Pus10-like isoform X2 [Cicer arietinum] Length = 508 Score = 111 bits (277), Expect = 1e-22 Identities = 50/55 (90%), Positives = 54/55 (98%) Frame = +1 Query: 4 NSQYFQLHLCTQAGTYIKEFVHGDLGRTHPSIGSILGCRAEILQLDVTDVKMDCF 168 +SQYF LHLCTQAGTYIKEFVHGDLGRTHPSIGS+LGCRAEILQLDVTD+KM+CF Sbjct: 452 SSQYFLLHLCTQAGTYIKEFVHGDLGRTHPSIGSMLGCRAEILQLDVTDIKMECF 506 >ref|XP_006342101.1| PREDICTED: putative tRNA pseudouridine synthase Pus10-like [Solanum tuberosum] Length = 560 Score = 110 bits (275), Expect = 2e-22 Identities = 51/56 (91%), Positives = 52/56 (92%) Frame = +1 Query: 1 GNSQYFQLHLCTQAGTYIKEFVHGDLGRTHPSIGSILGCRAEILQLDVTDVKMDCF 168 G+SQYF LHLCTQAGTYIKEFVHGD GRT PSIGSILGCR EILQLDVTDVKMDCF Sbjct: 502 GSSQYFLLHLCTQAGTYIKEFVHGDFGRTQPSIGSILGCRTEILQLDVTDVKMDCF 557 >ref|XP_004238405.1| PREDICTED: putative tRNA pseudouridine synthase Pus10-like [Solanum lycopersicum] Length = 557 Score = 108 bits (269), Expect = 1e-21 Identities = 50/56 (89%), Positives = 51/56 (91%) Frame = +1 Query: 1 GNSQYFQLHLCTQAGTYIKEFVHGDLGRTHPSIGSILGCRAEILQLDVTDVKMDCF 168 G+SQY LHLCTQAGTYIKEFVHGD GRT PSIGSILGCR EILQLDVTDVKMDCF Sbjct: 499 GSSQYLLLHLCTQAGTYIKEFVHGDFGRTQPSIGSILGCRTEILQLDVTDVKMDCF 554 >ref|XP_004172989.1| PREDICTED: putative tRNA pseudouridine synthase Pus10-like [Cucumis sativus] Length = 66 Score = 108 bits (269), Expect = 1e-21 Identities = 49/54 (90%), Positives = 52/54 (96%) Frame = +1 Query: 4 NSQYFQLHLCTQAGTYIKEFVHGDLGRTHPSIGSILGCRAEILQLDVTDVKMDC 165 +SQY+ LHLCTQAGTYIKEFVHGDLGRTHPSIGSIL CRAEILQLDVTD+KMDC Sbjct: 9 SSQYYLLHLCTQAGTYIKEFVHGDLGRTHPSIGSILSCRAEILQLDVTDIKMDC 62 >ref|XP_004145592.1| PREDICTED: putative tRNA pseudouridine synthase Pus10-like [Cucumis sativus] Length = 497 Score = 108 bits (269), Expect = 1e-21 Identities = 49/54 (90%), Positives = 52/54 (96%) Frame = +1 Query: 4 NSQYFQLHLCTQAGTYIKEFVHGDLGRTHPSIGSILGCRAEILQLDVTDVKMDC 165 +SQY+ LHLCTQAGTYIKEFVHGDLGRTHPSIGSIL CRAEILQLDVTD+KMDC Sbjct: 440 SSQYYLLHLCTQAGTYIKEFVHGDLGRTHPSIGSILSCRAEILQLDVTDIKMDC 493 >gb|ADN34134.1| hypothetical protein [Cucumis melo subsp. melo] Length = 501 Score = 108 bits (269), Expect = 1e-21 Identities = 49/54 (90%), Positives = 52/54 (96%) Frame = +1 Query: 4 NSQYFQLHLCTQAGTYIKEFVHGDLGRTHPSIGSILGCRAEILQLDVTDVKMDC 165 +SQY+ LHLCTQAGTYIKEFVHGDLGRTHPSIGSIL CRAEILQLDVTD+KMDC Sbjct: 444 SSQYYLLHLCTQAGTYIKEFVHGDLGRTHPSIGSILSCRAEILQLDVTDIKMDC 497