BLASTX nr result
ID: Cocculus22_contig00026736
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00026736 (397 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007218959.1| hypothetical protein PRUPE_ppa003559mg [Prun... 60 4e-07 ref|XP_007201170.1| hypothetical protein PRUPE_ppa003618mg [Prun... 58 2e-06 >ref|XP_007218959.1| hypothetical protein PRUPE_ppa003559mg [Prunus persica] gi|462415421|gb|EMJ20158.1| hypothetical protein PRUPE_ppa003559mg [Prunus persica] Length = 565 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -1 Query: 124 CNIFSSIIPPVFRKTKALPIETVFKLPSPLPSWPQGEGFAT 2 C S+ VF+K+KALPIET FKLP+PLPSWP G+GFA+ Sbjct: 4 CAALSASARGVFKKSKALPIETTFKLPAPLPSWPPGDGFAS 44 >ref|XP_007201170.1| hypothetical protein PRUPE_ppa003618mg [Prunus persica] gi|462396570|gb|EMJ02369.1| hypothetical protein PRUPE_ppa003618mg [Prunus persica] Length = 561 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = -1 Query: 124 CNIFSSIIPPVFRKTKALPIETVFKLPSPLPSWPQGEGFAT 2 C S+ VF+ +KALPIET FKLP+PLPSWP G+GFA+ Sbjct: 4 CAALSASARGVFKNSKALPIETTFKLPAPLPSWPPGDGFAS 44