BLASTX nr result
ID: Cocculus22_contig00026723
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00026723 (341 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME88945.1| hypothetical protein MYCFIDRAFT_181388 [Pseudocer... 69 5e-10 gb|EME49829.1| hypothetical protein DOTSEDRAFT_68580 [Dothistrom... 59 9e-07 gb|EMF17473.1| hypothetical protein SEPMUDRAFT_146493 [Sphaeruli... 56 5e-06 >gb|EME88945.1| hypothetical protein MYCFIDRAFT_181388 [Pseudocercospora fijiensis CIRAD86] Length = 261 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -3 Query: 114 HVVNKCDYEVTLCNVPASGGGYDQQDKTLAAGES 13 +VVNKCDYEVTLCNVP+SGGGY+Q+DKTLAAGES Sbjct: 9 YVVNKCDYEVTLCNVPSSGGGYNQEDKTLAAGES 42 >gb|EME49829.1| hypothetical protein DOTSEDRAFT_68580 [Dothistroma septosporum NZE10] Length = 304 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -3 Query: 111 VVNKCDYEVTLCNVPASGGGYDQQDKTLAAGES 13 VVNKCDY+V LCN PASGGGYD DKTL+ G+S Sbjct: 26 VVNKCDYDVYLCNTPASGGGYDSVDKTLSPGDS 58 >gb|EMF17473.1| hypothetical protein SEPMUDRAFT_146493 [Sphaerulina musiva SO2202] Length = 292 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -3 Query: 114 HVVNKCDYEVTLCNVPASGGGYDQQDKTLAAGES 13 HV+N+C+Y V LC+VP+SGGG +Q+DK LAAGES Sbjct: 32 HVINQCNYPVKLCSVPSSGGGQEQEDKILAAGES 65