BLASTX nr result
ID: Cocculus22_contig00026658
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00026658 (324 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006435857.1| hypothetical protein CICLE_v10032836mg [Citr... 57 2e-06 ref|XP_002312194.1| hypothetical protein POPTR_0008s07550g [Popu... 57 4e-06 gb|EXB25862.1| hypothetical protein L484_012288 [Morus notabilis] 56 5e-06 ref|XP_002520786.1| conserved hypothetical protein [Ricinus comm... 56 5e-06 >ref|XP_006435857.1| hypothetical protein CICLE_v10032836mg [Citrus clementina] gi|568865719|ref|XP_006486219.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2-like [Citrus sinensis] gi|557538053|gb|ESR49097.1| hypothetical protein CICLE_v10032836mg [Citrus clementina] Length = 190 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = +3 Query: 186 DEAAEALHQVGAISVIWSIPKSTKDSEVMNYKYRILRRFQDIKYD 320 DEAA ALH GAISVI S P S D+EV YK +L+RFQD++YD Sbjct: 143 DEAAGALHHAGAISVIKSTPDSLDDAEVEKYKSSLLKRFQDLRYD 187 >ref|XP_002312194.1| hypothetical protein POPTR_0008s07550g [Populus trichocarpa] gi|222852014|gb|EEE89561.1| hypothetical protein POPTR_0008s07550g [Populus trichocarpa] Length = 190 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/46 (56%), Positives = 36/46 (78%) Frame = +3 Query: 186 DEAAEALHQVGAISVIWSIPKSTKDSEVMNYKYRILRRFQDIKYDN 323 DEA ALH GAISVI SIP S++++E+ +K +L+RFQD+KY+N Sbjct: 143 DEALGALHLAGAISVIKSIPDSSEEAEIEKFKASLLKRFQDLKYEN 188 >gb|EXB25862.1| hypothetical protein L484_012288 [Morus notabilis] Length = 185 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/44 (59%), Positives = 34/44 (77%) Frame = +3 Query: 189 EAAEALHQVGAISVIWSIPKSTKDSEVMNYKYRILRRFQDIKYD 320 +AAEALH GAI++I S P S++D EV YK +L+RFQD+KYD Sbjct: 139 QAAEALHNAGAIAIISSTPDSSEDVEVEKYKASLLQRFQDLKYD 182 >ref|XP_002520786.1| conserved hypothetical protein [Ricinus communis] gi|223539917|gb|EEF41495.1| conserved hypothetical protein [Ricinus communis] Length = 156 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/46 (54%), Positives = 35/46 (76%) Frame = +3 Query: 186 DEAAEALHQVGAISVIWSIPKSTKDSEVMNYKYRILRRFQDIKYDN 323 DEA ALH GAISVI S P S +++E+ NYK +L+RFQ+++YD+ Sbjct: 111 DEAVGALHNAGAISVIKSTPDSPEEAEIKNYKSSLLKRFQELRYDS 156