BLASTX nr result
ID: Cocculus22_contig00026577
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00026577 (364 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006473956.1| PREDICTED: leucine-rich repeat receptor-like... 74 2e-11 ref|XP_006453684.1| hypothetical protein CICLE_v10007366mg [Citr... 74 2e-11 ref|XP_002264530.2| PREDICTED: leucine-rich repeat receptor-like... 72 8e-11 emb|CBI25609.3| unnamed protein product [Vitis vinifera] 72 8e-11 ref|XP_002325155.1| leucine-rich repeat transmembrane protein ki... 71 2e-10 ref|XP_002308383.2| hypothetical protein POPTR_0006s20330g [Popu... 69 5e-10 ref|XP_007012012.1| Leucine-rich repeat transmembrane protein ki... 68 2e-09 gb|EXC12521.1| Leucine-rich repeat receptor-like protein kinase ... 67 3e-09 ref|XP_002523535.1| Receptor protein kinase CLAVATA1 precursor, ... 64 2e-08 ref|XP_004514666.1| PREDICTED: leucine-rich repeat receptor-like... 63 5e-08 ref|XP_003546623.1| PREDICTED: leucine-rich repeat receptor-like... 62 6e-08 ref|XP_006587146.1| PREDICTED: leucine-rich repeat receptor-like... 61 1e-07 ref|XP_007203226.1| hypothetical protein PRUPE_ppa000884mg [Prun... 60 2e-07 ref|XP_003594469.1| Receptor-like kinase [Medicago truncatula] g... 60 3e-07 ref|XP_006343694.1| PREDICTED: leucine-rich repeat receptor-like... 59 5e-07 ref|XP_007138433.1| hypothetical protein PHAVU_009G208500g [Phas... 56 6e-06 >ref|XP_006473956.1| PREDICTED: leucine-rich repeat receptor-like protein kinase TDR-like [Citrus sinensis] Length = 955 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = -3 Query: 362 NEVGSTDAMRDEIKMVLEVALLCTGSRSSDRPSMEEALKLLSGLKP 225 NEVGS+ +++DEIK+VL+VALLCT S SDRPSMEEALKLLSGLKP Sbjct: 907 NEVGSSSSLQDEIKLVLDVALLCTRSTPSDRPSMEEALKLLSGLKP 952 >ref|XP_006453684.1| hypothetical protein CICLE_v10007366mg [Citrus clementina] gi|557556910|gb|ESR66924.1| hypothetical protein CICLE_v10007366mg [Citrus clementina] Length = 955 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = -3 Query: 362 NEVGSTDAMRDEIKMVLEVALLCTGSRSSDRPSMEEALKLLSGLKP 225 NEVGS+ +++DEIK+VL+VALLCT S SDRPSMEEALKLLSGLKP Sbjct: 907 NEVGSSSSLQDEIKLVLDVALLCTRSTPSDRPSMEEALKLLSGLKP 952 >ref|XP_002264530.2| PREDICTED: leucine-rich repeat receptor-like protein kinase TDR-like [Vitis vinifera] Length = 972 Score = 72.0 bits (175), Expect = 8e-11 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = -3 Query: 362 NEVGSTDAMRDEIKMVLEVALLCTGSRSSDRPSMEEALKLLSGLKPRR 219 NEVGS D+M++EIK+V EVALLCT SR SDRPSME+ L LLSGLK +R Sbjct: 912 NEVGSADSMQEEIKLVFEVALLCTRSRPSDRPSMEDVLNLLSGLKSQR 959 >emb|CBI25609.3| unnamed protein product [Vitis vinifera] Length = 827 Score = 72.0 bits (175), Expect = 8e-11 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = -3 Query: 362 NEVGSTDAMRDEIKMVLEVALLCTGSRSSDRPSMEEALKLLSGLKPRR 219 NEVGS D+M++EIK+V EVALLCT SR SDRPSME+ L LLSGLK +R Sbjct: 767 NEVGSADSMQEEIKLVFEVALLCTRSRPSDRPSMEDVLNLLSGLKSQR 814 >ref|XP_002325155.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] gi|222866589|gb|EEF03720.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] Length = 953 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/48 (70%), Positives = 42/48 (87%) Frame = -3 Query: 362 NEVGSTDAMRDEIKMVLEVALLCTGSRSSDRPSMEEALKLLSGLKPRR 219 N+ GSTD+ ++EIK+VLEVALLC SR SDRPSME+ALKLLSG+K +R Sbjct: 905 NQTGSTDSTQEEIKLVLEVALLCIKSRPSDRPSMEDALKLLSGMKSQR 952 >ref|XP_002308383.2| hypothetical protein POPTR_0006s20330g [Populus trichocarpa] gi|550336712|gb|EEE91906.2| hypothetical protein POPTR_0006s20330g [Populus trichocarpa] Length = 771 Score = 69.3 bits (168), Expect = 5e-10 Identities = 34/49 (69%), Positives = 40/49 (81%) Frame = -3 Query: 362 NEVGSTDAMRDEIKMVLEVALLCTGSRSSDRPSMEEALKLLSGLKPRRN 216 N+ GS DAM++EIK+V EVALLC SR SDRPSME+ALKLLSG+K N Sbjct: 723 NQTGSADAMQEEIKLVFEVALLCMRSRPSDRPSMEDALKLLSGVKSEVN 771 >ref|XP_007012012.1| Leucine-rich repeat transmembrane protein kinase family protein [Theobroma cacao] gi|508782375|gb|EOY29631.1| Leucine-rich repeat transmembrane protein kinase family protein [Theobroma cacao] Length = 953 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/47 (65%), Positives = 42/47 (89%) Frame = -3 Query: 362 NEVGSTDAMRDEIKMVLEVALLCTGSRSSDRPSMEEALKLLSGLKPR 222 +E GS +++++E+K VL+VA+LCT SR +DRPSMEEALKLLSGLKP+ Sbjct: 905 SEAGSANSLQEEVKPVLDVAMLCTRSRPADRPSMEEALKLLSGLKPQ 951 >gb|EXC12521.1| Leucine-rich repeat receptor-like protein kinase TDR [Morus notabilis] Length = 1203 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/48 (66%), Positives = 43/48 (89%) Frame = -3 Query: 362 NEVGSTDAMRDEIKMVLEVALLCTGSRSSDRPSMEEALKLLSGLKPRR 219 NEVGS+ +++++IK+VLEVALLCT SR +DRP+MEEALKLLSG + +R Sbjct: 908 NEVGSSTSIQEDIKVVLEVALLCTRSRPTDRPTMEEALKLLSGSQSQR 955 >ref|XP_002523535.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus communis] gi|223537242|gb|EEF38874.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus communis] Length = 958 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/44 (68%), Positives = 39/44 (88%) Frame = -3 Query: 350 STDAMRDEIKMVLEVALLCTGSRSSDRPSMEEALKLLSGLKPRR 219 S+++M++EIK VLEVALLCT SR +DRP ME+ALKLLSG +P+R Sbjct: 914 SSESMQEEIKQVLEVALLCTRSRPADRPPMEDALKLLSGFRPQR 957 >ref|XP_004514666.1| PREDICTED: leucine-rich repeat receptor-like protein kinase TDR-like [Cicer arietinum] Length = 982 Score = 62.8 bits (151), Expect = 5e-08 Identities = 33/45 (73%), Positives = 40/45 (88%) Frame = -3 Query: 362 NEVGSTDAMRDEIKMVLEVALLCTGSRSSDRPSMEEALKLLSGLK 228 NEV ST +++D IK+VLEVA+LCT SRSSDRPSM++ALKLLS LK Sbjct: 930 NEVSSTSSIQD-IKLVLEVAMLCTRSRSSDRPSMDDALKLLSRLK 973 >ref|XP_003546623.1| PREDICTED: leucine-rich repeat receptor-like protein kinase TDR-like [Glycine max] Length = 960 Score = 62.4 bits (150), Expect = 6e-08 Identities = 34/52 (65%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = -3 Query: 362 NEVGSTDAMR-DEIKMVLEVALLCTGSRSSDRPSMEEALKLLSGLKPRRNSR 210 NE G++ A EIK+VLEVA+LCT SRSSDRPSME+ LKLLSGLK + R Sbjct: 903 NENGASSASSLQEIKLVLEVAMLCTRSRSSDRPSMEDVLKLLSGLKHLEDGR 954 >ref|XP_006587146.1| PREDICTED: leucine-rich repeat receptor-like protein kinase TDR-like [Glycine max] Length = 955 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/48 (64%), Positives = 38/48 (79%) Frame = -3 Query: 353 GSTDAMRDEIKMVLEVALLCTGSRSSDRPSMEEALKLLSGLKPRRNSR 210 G++ + EIK+VLEVA+LCT SRSSDRPSME+ LKLLSGLK + R Sbjct: 903 GTSASSLHEIKLVLEVAMLCTQSRSSDRPSMEDVLKLLSGLKHLEDGR 950 >ref|XP_007203226.1| hypothetical protein PRUPE_ppa000884mg [Prunus persica] gi|462398757|gb|EMJ04425.1| hypothetical protein PRUPE_ppa000884mg [Prunus persica] Length = 971 Score = 60.5 bits (145), Expect = 2e-07 Identities = 31/50 (62%), Positives = 37/50 (74%) Frame = -3 Query: 362 NEVGSTDAMRDEIKMVLEVALLCTGSRSSDRPSMEEALKLLSGLKPRRNS 213 NEVG+ +R+EIK+VLEVA LCT SR SDRPSME LKLLS K + + Sbjct: 908 NEVGTNVPVREEIKLVLEVATLCTRSRPSDRPSMENTLKLLSEWKSNQKN 957 >ref|XP_003594469.1| Receptor-like kinase [Medicago truncatula] gi|355483517|gb|AES64720.1| Receptor-like kinase [Medicago truncatula] Length = 923 Score = 60.1 bits (144), Expect = 3e-07 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = -3 Query: 362 NEVGSTDAMRDEIKMVLEVALLCTGSRSSDRPSMEEALKLLS 237 NEV S +M +EIK+VLEVA+LCT SRSSDRPSME+ALKLLS Sbjct: 879 NEVTSASSM-EEIKLVLEVAMLCTRSRSSDRPSMEDALKLLS 919 >ref|XP_006343694.1| PREDICTED: leucine-rich repeat receptor-like protein kinase TDR-like [Solanum tuberosum] Length = 963 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/45 (62%), Positives = 38/45 (84%) Frame = -3 Query: 362 NEVGSTDAMRDEIKMVLEVALLCTGSRSSDRPSMEEALKLLSGLK 228 N+V + ++++EIK+VLEVA LCT R SDRPSME+ALKL++GLK Sbjct: 916 NDVAPSSSVQEEIKLVLEVASLCTRVRPSDRPSMEDALKLVTGLK 960 >ref|XP_007138433.1| hypothetical protein PHAVU_009G208500g [Phaseolus vulgaris] gi|561011520|gb|ESW10427.1| hypothetical protein PHAVU_009G208500g [Phaseolus vulgaris] Length = 958 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = -3 Query: 362 NEVGSTDAMRDEIKMVLEVALLCTGSRSSDRPSMEEALKLLSGLK 228 NE S ++ EIK+VLEVA+ CT SRSSD+PSME+ LK LSGLK Sbjct: 903 NEASSASSLH-EIKLVLEVAMFCTRSRSSDQPSMEDVLKHLSGLK 946