BLASTX nr result
ID: Cocculus22_contig00026449
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00026449 (401 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADJ67432.1| ethylene response factor 3 [Actinidia deliciosa] 56 6e-06 >gb|ADJ67432.1| ethylene response factor 3 [Actinidia deliciosa] Length = 341 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -1 Query: 401 NPDAKLLGSLCHMEQALPGVDYSYNFIKEGKEDELYGCESDDIGF 267 NPDAKLLGSL HMEQA P VDY +F+K G+E++ + DD+GF Sbjct: 289 NPDAKLLGSLNHMEQAPPVVDYGLDFLKPGREED-FNFALDDLGF 332