BLASTX nr result
ID: Cocculus22_contig00026440
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00026440 (338 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI34375.3| unnamed protein product [Vitis vinifera] 65 7e-09 >emb|CBI34375.3| unnamed protein product [Vitis vinifera] Length = 814 Score = 65.5 bits (158), Expect = 7e-09 Identities = 36/65 (55%), Positives = 45/65 (69%) Frame = -1 Query: 197 SIQSLVGHGLYPQALRASATLFDLCLTDQIYSLFKKSGSFLDIFLGSYLIDCFSKSGDLC 18 SI++LV LYPQALRASA+L LTDQ Y+LF KSG LD FL S++++ F+ SGD Sbjct: 13 SIKTLVLKRLYPQALRASASLLHPPLTDQSYALFLKSGFALDAFLSSFIVNRFAISGDFA 72 Query: 17 HAHCF 3 A F Sbjct: 73 RARRF 77