BLASTX nr result
ID: Cocculus22_contig00026400
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00026400 (366 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007029665.1| Leucine-rich repeat containing protein, puta... 68 2e-09 >ref|XP_007029665.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma cacao] gi|590639427|ref|XP_007029666.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma cacao] gi|590639430|ref|XP_007029667.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma cacao] gi|590639433|ref|XP_007029668.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma cacao] gi|590639436|ref|XP_007029669.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma cacao] gi|590639439|ref|XP_007029670.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma cacao] gi|508718270|gb|EOY10167.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma cacao] gi|508718271|gb|EOY10168.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma cacao] gi|508718272|gb|EOY10169.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma cacao] gi|508718273|gb|EOY10170.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma cacao] gi|508718274|gb|EOY10171.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma cacao] gi|508718275|gb|EOY10172.1| Leucine-rich repeat containing protein, putative isoform 1 [Theobroma cacao] Length = 881 Score = 67.8 bits (164), Expect = 2e-09 Identities = 37/94 (39%), Positives = 52/94 (55%) Frame = +1 Query: 28 VKNKVLNFFSCFNTLAVHSKAAHAIQIICKRLKVINEEMDNFHLEIAKKDDSSNITMNAP 207 + NKV NFFS N L K AH I+ I +R I + D FHL + K DD+ ++ ++ Sbjct: 98 IGNKVCNFFSSSNPLVFRLKMAHKIKKITERFSEIADLRDRFHL-VEKHDDTMHVVLSDR 156 Query: 208 ETFSLVDELEEIGRETDKSKIVNMLIHGSTNNDQ 309 ET S V + IGR+ DK KIV L+ T ++ Sbjct: 157 ETHSFVQASDVIGRDIDKKKIVESLLQAPTGGEE 190