BLASTX nr result
ID: Cocculus22_contig00026293
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00026293 (432 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI17294.3| unnamed protein product [Vitis vinifera] 86 7e-15 ref|XP_002265361.1| PREDICTED: uncharacterized protein LOC100264... 86 7e-15 ref|XP_004296958.1| PREDICTED: kinesin-like protein KIN12B-like ... 82 8e-14 ref|XP_007225458.1| hypothetical protein PRUPE_ppa000288mg [Prun... 82 8e-14 ref|XP_007034157.1| Phragmoplast-associated kinesin-related prot... 81 1e-13 ref|XP_007034155.1| Phragmoplast-associated kinesin-related prot... 81 1e-13 gb|EXB54784.1| Kinesin-like protein KIF15 [Morus notabilis] 79 8e-13 ref|XP_002321106.2| PHRAGMOPLAST-ASSOCIATED KINESIN-RELATED prot... 77 2e-12 ref|XP_002516381.1| Carboxy-terminal kinesin, putative [Ricinus ... 70 3e-10 ref|XP_002303008.1| PHRAGMOPLAST-ASSOCIATED KINESIN-RELATED prot... 70 4e-10 ref|XP_006418852.1| hypothetical protein EUTSA_v10002371mg [Eutr... 67 3e-09 ref|XP_006492986.1| PREDICTED: kinesin-like protein KIN12B-like ... 67 3e-09 ref|XP_006421052.1| hypothetical protein CICLE_v10004158mg [Citr... 67 3e-09 gb|EYU24277.1| hypothetical protein MIMGU_mgv1a000402mg [Mimulus... 63 4e-08 ref|XP_002868307.1| hypothetical protein ARALYDRAFT_915478 [Arab... 60 2e-07 ref|XP_006414787.1| hypothetical protein EUTSA_v10024229mg [Eutr... 60 3e-07 ref|XP_002883450.1| PAKRP1L [Arabidopsis lyrata subsp. lyrata] g... 60 3e-07 ref|NP_567423.1| phragmoplast-associated kinesin-related protein... 60 4e-07 ref|XP_006296836.1| hypothetical protein CARUB_v10012821mg [Caps... 59 7e-07 ref|NP_001030750.1| kinesin-like protein KIN12B [Arabidopsis tha... 59 7e-07 >emb|CBI17294.3| unnamed protein product [Vitis vinifera] Length = 1251 Score = 85.5 bits (210), Expect = 7e-15 Identities = 36/44 (81%), Positives = 38/44 (86%) Frame = +2 Query: 29 GEGHSAAEQQWREEFEPFYPGEDGEFSKLVEPSSWFSGYDRCNI 160 GE H+A +QQWREEFEPFY GED E SKL EPSSWFSGYDRCNI Sbjct: 1208 GESHTACDQQWREEFEPFYNGEDSELSKLAEPSSWFSGYDRCNI 1251 >ref|XP_002265361.1| PREDICTED: uncharacterized protein LOC100264192 [Vitis vinifera] Length = 1354 Score = 85.5 bits (210), Expect = 7e-15 Identities = 36/44 (81%), Positives = 38/44 (86%) Frame = +2 Query: 29 GEGHSAAEQQWREEFEPFYPGEDGEFSKLVEPSSWFSGYDRCNI 160 GE H+A +QQWREEFEPFY GED E SKL EPSSWFSGYDRCNI Sbjct: 1311 GESHTACDQQWREEFEPFYNGEDSELSKLAEPSSWFSGYDRCNI 1354 >ref|XP_004296958.1| PREDICTED: kinesin-like protein KIN12B-like [Fragaria vesca subsp. vesca] Length = 1238 Score = 82.0 bits (201), Expect = 8e-14 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = +2 Query: 29 GEGHSAAEQQWREEFEPFYPGEDGEFSKLVEPSSWFSGYDRCNI 160 GE HS ++Q+W+EEFEPFY GEDGE KL EPSSWFSGYDRCNI Sbjct: 1195 GEPHSLSDQRWKEEFEPFYNGEDGELRKLAEPSSWFSGYDRCNI 1238 >ref|XP_007225458.1| hypothetical protein PRUPE_ppa000288mg [Prunus persica] gi|462422394|gb|EMJ26657.1| hypothetical protein PRUPE_ppa000288mg [Prunus persica] Length = 1340 Score = 82.0 bits (201), Expect = 8e-14 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = +2 Query: 29 GEGHSAAEQQWREEFEPFYPGEDGEFSKLVEPSSWFSGYDRCNI 160 GE HS ++Q+W+EEFEPFY GEDGE KL EPSSWFSGYDRCNI Sbjct: 1297 GEPHSLSDQRWKEEFEPFYNGEDGELRKLTEPSSWFSGYDRCNI 1340 >ref|XP_007034157.1| Phragmoplast-associated kinesin-related protein, putative isoform 3 [Theobroma cacao] gi|508713186|gb|EOY05083.1| Phragmoplast-associated kinesin-related protein, putative isoform 3 [Theobroma cacao] Length = 1206 Score = 81.3 bits (199), Expect = 1e-13 Identities = 35/44 (79%), Positives = 38/44 (86%) Frame = +2 Query: 29 GEGHSAAEQQWREEFEPFYPGEDGEFSKLVEPSSWFSGYDRCNI 160 GE H A++Q+WREEFEPFY GEDGE SKL E SSWFSGYDRCNI Sbjct: 1163 GETHYASDQRWREEFEPFYNGEDGELSKLAENSSWFSGYDRCNI 1206 >ref|XP_007034155.1| Phragmoplast-associated kinesin-related protein, putative isoform 1 [Theobroma cacao] gi|508713184|gb|EOY05081.1| Phragmoplast-associated kinesin-related protein, putative isoform 1 [Theobroma cacao] Length = 1264 Score = 81.3 bits (199), Expect = 1e-13 Identities = 35/44 (79%), Positives = 38/44 (86%) Frame = +2 Query: 29 GEGHSAAEQQWREEFEPFYPGEDGEFSKLVEPSSWFSGYDRCNI 160 GE H A++Q+WREEFEPFY GEDGE SKL E SSWFSGYDRCNI Sbjct: 1221 GETHYASDQRWREEFEPFYNGEDGELSKLAENSSWFSGYDRCNI 1264 >gb|EXB54784.1| Kinesin-like protein KIF15 [Morus notabilis] Length = 1345 Score = 78.6 bits (192), Expect = 8e-13 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +2 Query: 44 AAEQQWREEFEPFYPGEDGEFSKLVEPSSWFSGYDRCNI 160 A++QQWREEFEPFY GEDGE KL EPSSWFSGYDRCNI Sbjct: 1307 ASDQQWREEFEPFYNGEDGELPKLAEPSSWFSGYDRCNI 1345 >ref|XP_002321106.2| PHRAGMOPLAST-ASSOCIATED KINESIN-RELATED protein 1 [Populus trichocarpa] gi|550324210|gb|EEE99421.2| PHRAGMOPLAST-ASSOCIATED KINESIN-RELATED protein 1 [Populus trichocarpa] Length = 1289 Score = 77.0 bits (188), Expect = 2e-12 Identities = 33/44 (75%), Positives = 35/44 (79%) Frame = +2 Query: 29 GEGHSAAEQQWREEFEPFYPGEDGEFSKLVEPSSWFSGYDRCNI 160 GE +QQWREEFEPFY +DGE SKL EPSSWFSGYDRCNI Sbjct: 1246 GEPLGEGDQQWREEFEPFYKAKDGELSKLAEPSSWFSGYDRCNI 1289 >ref|XP_002516381.1| Carboxy-terminal kinesin, putative [Ricinus communis] gi|223544479|gb|EEF45998.1| Carboxy-terminal kinesin, putative [Ricinus communis] Length = 1282 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/38 (81%), Positives = 33/38 (86%), Gaps = 2/38 (5%) Frame = +2 Query: 53 QQWREEFEPFYP--GEDGEFSKLVEPSSWFSGYDRCNI 160 ++WREEFEPFY GEDGE SKL EPSSWFSGYDRCNI Sbjct: 1245 ERWREEFEPFYNNNGEDGELSKLTEPSSWFSGYDRCNI 1282 >ref|XP_002303008.1| PHRAGMOPLAST-ASSOCIATED KINESIN-RELATED protein 1 [Populus trichocarpa] gi|222844734|gb|EEE82281.1| PHRAGMOPLAST-ASSOCIATED KINESIN-RELATED protein 1 [Populus trichocarpa] Length = 1294 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/46 (69%), Positives = 36/46 (78%), Gaps = 2/46 (4%) Frame = +2 Query: 29 GEGHSAAEQQWREEFEPFYPGEDGE--FSKLVEPSSWFSGYDRCNI 160 GE S +++WREEFEPFY EDGE SKL EPS+WFSGYDRCNI Sbjct: 1249 GEPLSEGDERWREEFEPFYNVEDGEGELSKLAEPSAWFSGYDRCNI 1294 >ref|XP_006418852.1| hypothetical protein EUTSA_v10002371mg [Eutrema salsugineum] gi|557096780|gb|ESQ37288.1| hypothetical protein EUTSA_v10002371mg [Eutrema salsugineum] Length = 1342 Score = 67.0 bits (162), Expect = 3e-09 Identities = 34/53 (64%), Positives = 39/53 (73%) Frame = +2 Query: 2 DDPIGVTHEGEGHSAAEQQWREEFEPFYPGEDGEFSKLVEPSSWFSGYDRCNI 160 D+P+ E S+ +QQWREEFEPFY +D E SKLVEP SWFSGYDRCNI Sbjct: 1296 DEPV----EPSSASSGDQQWREEFEPFYK-KDSELSKLVEP-SWFSGYDRCNI 1342 >ref|XP_006492986.1| PREDICTED: kinesin-like protein KIN12B-like [Citrus sinensis] Length = 1345 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +2 Query: 26 EGEGHSAAEQQWREEFEPFYPGEDGEFSKLVEPSSWFSGYDRCNI 160 E E HSA +QQWREEF+ FY +D E SKL EP SWFSGYDRCNI Sbjct: 1303 EEEPHSAGDQQWREEFQQFYT-DDSEISKLAEP-SWFSGYDRCNI 1345 >ref|XP_006421052.1| hypothetical protein CICLE_v10004158mg [Citrus clementina] gi|557522925|gb|ESR34292.1| hypothetical protein CICLE_v10004158mg [Citrus clementina] Length = 1344 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +2 Query: 26 EGEGHSAAEQQWREEFEPFYPGEDGEFSKLVEPSSWFSGYDRCNI 160 E E HSA +QQWREEF+ FY +D E SKL EP SWFSGYDRCNI Sbjct: 1302 EEEPHSAGDQQWREEFQQFYT-DDSEISKLAEP-SWFSGYDRCNI 1344 >gb|EYU24277.1| hypothetical protein MIMGU_mgv1a000402mg [Mimulus guttatus] Length = 1184 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/45 (64%), Positives = 31/45 (68%) Frame = +2 Query: 26 EGEGHSAAEQQWREEFEPFYPGEDGEFSKLVEPSSWFSGYDRCNI 160 EGEG +QQWREEF P Y G + E EPSSWFSGYDRCNI Sbjct: 1145 EGEGTGGGDQQWREEFAPSYDGVEDE-----EPSSWFSGYDRCNI 1184 >ref|XP_002868307.1| hypothetical protein ARALYDRAFT_915478 [Arabidopsis lyrata subsp. lyrata] gi|297314143|gb|EFH44566.1| hypothetical protein ARALYDRAFT_915478 [Arabidopsis lyrata subsp. lyrata] Length = 1287 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = +2 Query: 41 SAAEQQWREEFEPFYPGEDGEFSKLVEPSSWFSGYDRCNI 160 +A+EQQWR+EFEP Y E EFS L EP SWFSGYDRCNI Sbjct: 1250 NASEQQWRDEFEPLYKKET-EFSNLAEP-SWFSGYDRCNI 1287 >ref|XP_006414787.1| hypothetical protein EUTSA_v10024229mg [Eutrema salsugineum] gi|557115957|gb|ESQ56240.1| hypothetical protein EUTSA_v10024229mg [Eutrema salsugineum] Length = 1307 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/39 (76%), Positives = 31/39 (79%) Frame = +2 Query: 44 AAEQQWREEFEPFYPGEDGEFSKLVEPSSWFSGYDRCNI 160 A EQQWR+EFEP Y E EFSKL EPS WFSGYDRCNI Sbjct: 1271 ANEQQWRDEFEPLYEKE-AEFSKLGEPS-WFSGYDRCNI 1307 >ref|XP_002883450.1| PAKRP1L [Arabidopsis lyrata subsp. lyrata] gi|297329290|gb|EFH59709.1| PAKRP1L [Arabidopsis lyrata subsp. lyrata] Length = 1310 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/40 (72%), Positives = 31/40 (77%) Frame = +2 Query: 41 SAAEQQWREEFEPFYPGEDGEFSKLVEPSSWFSGYDRCNI 160 S + QWREEFEPFY +D E SKL EPS WFSGYDRCNI Sbjct: 1273 SDGDHQWREEFEPFYK-KDEELSKLAEPS-WFSGYDRCNI 1310 >ref|NP_567423.1| phragmoplast-associated kinesin-related protein 1 [Arabidopsis thaliana] gi|75173840|sp|Q9LDN0.1|KN12A_ARATH RecName: Full=Kinesin-like protein KIN12A; AltName: Full=Phragmoplast-associated kinesin-related protein 1; Short=AtPAKRP1 gi|8745333|gb|AAF78893.1| phragmoplast-associated kinesin-related protein 1 [Arabidopsis thaliana] gi|8745335|gb|AAF78894.1| phragmoplast-associated kinesin-related protein 1 [Arabidopsis thaliana] gi|332657984|gb|AEE83384.1| phragmoplast-associated kinesin-related protein 1 [Arabidopsis thaliana] Length = 1292 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +2 Query: 38 HSAAEQQWREEFEPFYPGEDGEFSKLVEPSSWFSGYDRCNI 160 ++++EQQWR+EFEP Y E EFS L EP SWFSGYDRCNI Sbjct: 1254 NASSEQQWRDEFEPLYKKET-EFSNLAEP-SWFSGYDRCNI 1292 >ref|XP_006296836.1| hypothetical protein CARUB_v10012821mg [Capsella rubella] gi|482565545|gb|EOA29734.1| hypothetical protein CARUB_v10012821mg [Capsella rubella] Length = 1343 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +2 Query: 41 SAAEQQWREEFEPFYPGEDGEFSKLVEPSSWFSGYDRCNI 160 S+ + QWREEFEP Y +D E SKL EPS WFSGYDRCNI Sbjct: 1306 SSGDHQWREEFEPVYKKDD-ELSKLAEPS-WFSGYDRCNI 1343 >ref|NP_001030750.1| kinesin-like protein KIN12B [Arabidopsis thaliana] gi|332643278|gb|AEE76799.1| kinesin-like protein KIN12B [Arabidopsis thaliana] Length = 971 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +2 Query: 41 SAAEQQWREEFEPFYPGEDGEFSKLVEPSSWFSGYDRCNI 160 S + QWREEF+PFY +D E SKL EPS WFSGYDRCNI Sbjct: 934 SDGDNQWREEFQPFYK-KDEELSKLAEPS-WFSGYDRCNI 971