BLASTX nr result
ID: Cocculus22_contig00026052
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00026052 (326 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007220669.1| hypothetical protein PRUPE_ppa015185mg [Prun... 71 2e-10 ref|XP_007021579.1| Disease resistance protein family [Theobroma... 69 9e-10 ref|XP_007021582.1| Disease resistance protein family [Theobroma... 67 2e-09 ref|XP_006303146.1| hypothetical protein CARUB_v10008267mg [Caps... 67 3e-09 ref|XP_006301835.1| hypothetical protein CARUB_v10022304mg, part... 67 3e-09 sp|P0C8S1.1|RP8L2_ARATH RecName: Full=Probable disease resistanc... 66 4e-09 ref|XP_007021583.1| CC-NBS-LRR class disease resistance protein,... 66 6e-09 ref|XP_002891747.1| hypothetical protein ARALYDRAFT_892371 [Arab... 66 6e-09 ref|XP_007021586.1| Disease resistance protein family [Theobroma... 65 8e-09 ref|XP_007021577.1| Disease resistance protein family isoform 1 ... 65 8e-09 ref|XP_002521786.1| Disease resistance protein RPP13, putative [... 65 1e-08 ref|XP_006392297.1| hypothetical protein EUTSA_v10023235mg [Eutr... 64 2e-08 ref|XP_007021588.1| CC-NBS-LRR class disease resistance protein ... 64 2e-08 emb|CBI37944.3| unnamed protein product [Vitis vinifera] 64 2e-08 ref|XP_006372175.1| hypothetical protein POPTR_0018s13530g [Popu... 64 2e-08 ref|XP_006306712.1| hypothetical protein CARUB_v10008237mg [Caps... 64 2e-08 gb|AAL32592.1| disease resistance protein RPP8 [Arabidopsis thal... 64 2e-08 ref|NP_199160.1| disease resistance protein RPP8 [Arabidopsis th... 64 2e-08 dbj|BAF01738.1| disease resistance protein RPP8 [Arabidopsis tha... 64 2e-08 ref|XP_007021585.1| CC-NBS-LRR class disease resistance protein ... 64 3e-08 >ref|XP_007220669.1| hypothetical protein PRUPE_ppa015185mg [Prunus persica] gi|462417131|gb|EMJ21868.1| hypothetical protein PRUPE_ppa015185mg [Prunus persica] Length = 893 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/60 (53%), Positives = 42/60 (70%) Frame = -2 Query: 325 GTMRNLLSLAIDSCKSLKKLPDGLQFLTNLQELVVVRMPQTFIDRYKEGGEDHWMVQHIP 146 G M +L L I+ C L +PDGLQ++T L+EL V RMP TF DR +EGGED + +QH+P Sbjct: 826 GAMSSLSRLHIEHCIDLTSVPDGLQYITTLKELHVKRMPSTFCDRLQEGGEDFYKIQHVP 885 >ref|XP_007021579.1| Disease resistance protein family [Theobroma cacao] gi|508721207|gb|EOY13104.1| Disease resistance protein family [Theobroma cacao] Length = 129 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/60 (51%), Positives = 41/60 (68%) Frame = -2 Query: 325 GTMRNLLSLAIDSCKSLKKLPDGLQFLTNLQELVVVRMPQTFIDRYKEGGEDHWMVQHIP 146 G M L L I++C+ LK LPDGL+F+T L+ L + RMP F D+ EGGED + VQH+P Sbjct: 57 GAMPTLRHLEIENCRKLKMLPDGLRFITTLRYLKIERMPMAFQDKLVEGGEDFYKVQHVP 116 >ref|XP_007021582.1| Disease resistance protein family [Theobroma cacao] gi|508721210|gb|EOY13107.1| Disease resistance protein family [Theobroma cacao] Length = 121 Score = 67.4 bits (163), Expect = 2e-09 Identities = 35/68 (51%), Positives = 45/68 (66%) Frame = -2 Query: 325 GTMRNLLSLAIDSCKSLKKLPDGLQFLTNLQELVVVRMPQTFIDRYKEGGEDHWMVQHIP 146 G M L L I CK+LK LP+GL+F+TNL++L + MP+ F D+ EGGED + VQHIP Sbjct: 54 GAMPALRHLEIFECKNLKMLPNGLRFITNLRKLEIGWMPKAFKDKLVEGGEDFYRVQHIP 113 Query: 145 KRRLEAFE 122 LE E Sbjct: 114 SIVLENCE 121 >ref|XP_006303146.1| hypothetical protein CARUB_v10008267mg [Capsella rubella] gi|482571857|gb|EOA36044.1| hypothetical protein CARUB_v10008267mg [Capsella rubella] Length = 888 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/60 (51%), Positives = 45/60 (75%) Frame = -2 Query: 325 GTMRNLLSLAIDSCKSLKKLPDGLQFLTNLQELVVVRMPQTFIDRYKEGGEDHWMVQHIP 146 G+M L +L ID+CK LK LPDGL+F+++L+EL + RM + + +R GGED++ VQHIP Sbjct: 820 GSMPCLRTLTIDNCKKLKHLPDGLKFISSLKELKIERMKREWTERLVIGGEDYYKVQHIP 879 >ref|XP_006301835.1| hypothetical protein CARUB_v10022304mg, partial [Capsella rubella] gi|482570545|gb|EOA34733.1| hypothetical protein CARUB_v10022304mg, partial [Capsella rubella] Length = 1678 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/68 (44%), Positives = 48/68 (70%) Frame = -2 Query: 325 GTMRNLLSLAIDSCKSLKKLPDGLQFLTNLQELVVVRMPQTFIDRYKEGGEDHWMVQHIP 146 G+M L +L + C++LK+LPDGL+F+T+L+EL + F+ + KEGGED++ VQHIP Sbjct: 686 GSMALLRTLTLRHCENLKELPDGLRFITSLKELSIYTSKWEFLVKLKEGGEDYYKVQHIP 745 Query: 145 KRRLEAFE 122 ++ F+ Sbjct: 746 LLKIPVFD 753 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/60 (41%), Positives = 42/60 (70%) Frame = -2 Query: 325 GTMRNLLSLAIDSCKSLKKLPDGLQFLTNLQELVVVRMPQTFIDRYKEGGEDHWMVQHIP 146 G+M L +L I C +L++LPDG++F+T+L+EL +V + F ++ G ED++ +QHIP Sbjct: 1592 GSMPLLHTLFISHCNNLRELPDGMRFITSLKELEIVTSDRRFKEKLYRGREDYYKIQHIP 1651 >sp|P0C8S1.1|RP8L2_ARATH RecName: Full=Probable disease resistance RPP8-like protein 2 Length = 906 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/60 (51%), Positives = 45/60 (75%) Frame = -2 Query: 325 GTMRNLLSLAIDSCKSLKKLPDGLQFLTNLQELVVVRMPQTFIDRYKEGGEDHWMVQHIP 146 G+M L +L ID+CK LK+LPDGL+++T L+EL + RM + + +R GGED++ VQHIP Sbjct: 838 GSMPCLRTLTIDNCKKLKQLPDGLKYVTCLKELKIERMKREWTERLVIGGEDYYKVQHIP 897 >ref|XP_007021583.1| CC-NBS-LRR class disease resistance protein, putative [Theobroma cacao] gi|508721211|gb|EOY13108.1| CC-NBS-LRR class disease resistance protein, putative [Theobroma cacao] Length = 931 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/60 (51%), Positives = 41/60 (68%) Frame = -2 Query: 325 GTMRNLLSLAIDSCKSLKKLPDGLQFLTNLQELVVVRMPQTFIDRYKEGGEDHWMVQHIP 146 G M L L I +C+ LK LP GL+F+T LQ+L + RMP+ F D+ EGGED + VQH+P Sbjct: 859 GAMPALCHLDIVNCRKLKMLPAGLRFITTLQQLKIDRMPKAFKDKLVEGGEDFYKVQHVP 918 >ref|XP_002891747.1| hypothetical protein ARALYDRAFT_892371 [Arabidopsis lyrata subsp. lyrata] gi|297337589|gb|EFH68006.1| hypothetical protein ARALYDRAFT_892371 [Arabidopsis lyrata subsp. lyrata] Length = 905 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/60 (48%), Positives = 45/60 (75%) Frame = -2 Query: 325 GTMRNLLSLAIDSCKSLKKLPDGLQFLTNLQELVVVRMPQTFIDRYKEGGEDHWMVQHIP 146 G+M L +L +D+CK LK+LPDGL+++ +L+EL + RM + + +R GGED++ VQHIP Sbjct: 837 GSMPCLRTLTVDNCKKLKQLPDGLEYVASLKELKIERMKREWTERLVLGGEDYYKVQHIP 896 >ref|XP_007021586.1| Disease resistance protein family [Theobroma cacao] gi|508721214|gb|EOY13111.1| Disease resistance protein family [Theobroma cacao] Length = 123 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/60 (50%), Positives = 39/60 (65%) Frame = -2 Query: 325 GTMRNLLSLAIDSCKSLKKLPDGLQFLTNLQELVVVRMPQTFIDRYKEGGEDHWMVQHIP 146 G M L L I C+ LK LPDGL+F+T L++L + MP F D+ EGGED + VQH+P Sbjct: 54 GAMPTLRHLEIGHCRKLKMLPDGLRFITTLRQLKIEMMPMAFKDKLVEGGEDFFKVQHVP 113 >ref|XP_007021577.1| Disease resistance protein family isoform 1 [Theobroma cacao] gi|590609586|ref|XP_007021578.1| Disease resistance protein family isoform 1 [Theobroma cacao] gi|508721205|gb|EOY13102.1| Disease resistance protein family isoform 1 [Theobroma cacao] gi|508721206|gb|EOY13103.1| Disease resistance protein family isoform 1 [Theobroma cacao] Length = 224 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/60 (50%), Positives = 40/60 (66%) Frame = -2 Query: 325 GTMRNLLSLAIDSCKSLKKLPDGLQFLTNLQELVVVRMPQTFIDRYKEGGEDHWMVQHIP 146 G M L L I+ C LK LPDGL+F+T L++L + MP+ F D+ EGGED + VQH+P Sbjct: 146 GAMPTLRHLEIEYCSELKMLPDGLRFITTLRQLKIEWMPKAFKDKLVEGGEDFYKVQHVP 205 >ref|XP_002521786.1| Disease resistance protein RPP13, putative [Ricinus communis] gi|223538999|gb|EEF40596.1| Disease resistance protein RPP13, putative [Ricinus communis] Length = 929 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/60 (48%), Positives = 42/60 (70%) Frame = -2 Query: 325 GTMRNLLSLAIDSCKSLKKLPDGLQFLTNLQELVVVRMPQTFIDRYKEGGEDHWMVQHIP 146 G M NL L I +C S+K +PDGL+F+T LQE+ + M + F R +EGG+D++ VQH+P Sbjct: 861 GAMSNLCHLEISNCTSMKMVPDGLRFITCLQEMEIRSMLKAFKTRLEEGGDDYYKVQHVP 920 >ref|XP_006392297.1| hypothetical protein EUTSA_v10023235mg [Eutrema salsugineum] gi|557088803|gb|ESQ29583.1| hypothetical protein EUTSA_v10023235mg [Eutrema salsugineum] Length = 991 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/60 (48%), Positives = 42/60 (70%) Frame = -2 Query: 325 GTMRNLLSLAIDSCKSLKKLPDGLQFLTNLQELVVVRMPQTFIDRYKEGGEDHWMVQHIP 146 G+M L SL I CK K+LPDGL+F+T+L+ L + M + + +R EGGED++ +QHIP Sbjct: 925 GSMPVLYSLVIKDCKKFKELPDGLRFITSLKNLKIEYMGEEWKERLSEGGEDYYKIQHIP 984 >ref|XP_007021588.1| CC-NBS-LRR class disease resistance protein [Theobroma cacao] gi|508721216|gb|EOY13113.1| CC-NBS-LRR class disease resistance protein [Theobroma cacao] Length = 615 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/60 (51%), Positives = 42/60 (70%) Frame = -2 Query: 325 GTMRNLLSLAIDSCKSLKKLPDGLQFLTNLQELVVVRMPQTFIDRYKEGGEDHWMVQHIP 146 G M L L I CK+LK LP+GL+F+TNL++L + +P+ F D+ EGGED + VQHIP Sbjct: 548 GAMPALRHLEIFECKNLKMLPNGLRFITNLRKLEIGWVPKAFKDKLVEGGEDFYKVQHIP 607 >emb|CBI37944.3| unnamed protein product [Vitis vinifera] Length = 787 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/64 (48%), Positives = 43/64 (67%) Frame = -2 Query: 319 MRNLLSLAIDSCKSLKKLPDGLQFLTNLQELVVVRMPQTFIDRYKEGGEDHWMVQHIPKR 140 M +LL L I C+ LKKLPDGL+ +T L+EL ++ MP F++R K GGED + VQ + Sbjct: 719 MPSLLELQIRRCEQLKKLPDGLRLVTTLRELEIIEMPNGFLNRLKVGGEDFYKVQQVHSI 778 Query: 139 RLEA 128 +L A Sbjct: 779 KLWA 782 >ref|XP_006372175.1| hypothetical protein POPTR_0018s13530g [Populus trichocarpa] gi|550318673|gb|ERP49972.1| hypothetical protein POPTR_0018s13530g [Populus trichocarpa] Length = 937 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/60 (46%), Positives = 42/60 (70%) Frame = -2 Query: 325 GTMRNLLSLAIDSCKSLKKLPDGLQFLTNLQELVVVRMPQTFIDRYKEGGEDHWMVQHIP 146 G M NL L I +C SLK +P+GL+F+T+L+E+ + M + F R + GGED++ VQH+P Sbjct: 857 GAMANLFHLEISNCTSLKTVPEGLRFITSLREMEIRSMLKAFRTRLEHGGEDYYKVQHVP 916 >ref|XP_006306712.1| hypothetical protein CARUB_v10008237mg [Capsella rubella] gi|482575423|gb|EOA39610.1| hypothetical protein CARUB_v10008237mg [Capsella rubella] Length = 928 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/60 (46%), Positives = 40/60 (66%) Frame = -2 Query: 325 GTMRNLLSLAIDSCKSLKKLPDGLQFLTNLQELVVVRMPQTFIDRYKEGGEDHWMVQHIP 146 G M L+S+ + SCK LK +P+GL+FL NLQE+ + M + F D+ GED + VQH+P Sbjct: 860 GAMMRLVSIEVKSCKKLKSVPEGLRFLKNLQEVEIGNMTKAFKDKLISSGEDFYKVQHVP 919 >gb|AAL32592.1| disease resistance protein RPP8 [Arabidopsis thaliana] Length = 908 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/60 (48%), Positives = 44/60 (73%) Frame = -2 Query: 325 GTMRNLLSLAIDSCKSLKKLPDGLQFLTNLQELVVVRMPQTFIDRYKEGGEDHWMVQHIP 146 G+M L +L ID CK LK+LPDGL+++T+L+EL + M + + ++ GGED++ VQHIP Sbjct: 840 GSMPCLRTLTIDDCKKLKELPDGLKYITSLKELKIEGMKREWKEKLVPGGEDYYKVQHIP 899 >ref|NP_199160.1| disease resistance protein RPP8 [Arabidopsis thaliana] gi|30694301|ref|NP_851124.1| disease resistance protein RPP8 [Arabidopsis thaliana] gi|29839585|sp|Q8W4J9.2|RPP8_ARATH RecName: Full=Disease resistance protein RPP8; AltName: Full=Resistance to Peronospora parasitica protein 8 gi|3901294|gb|AAC78631.1| rpp8 [Arabidopsis thaliana] gi|8843900|dbj|BAA97426.1| disease resistance protein RPP8 [Arabidopsis thaliana] gi|332007584|gb|AED94967.1| disease resistance protein RPP8 [Arabidopsis thaliana] gi|332007585|gb|AED94968.1| disease resistance protein RPP8 [Arabidopsis thaliana] Length = 908 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/60 (48%), Positives = 44/60 (73%) Frame = -2 Query: 325 GTMRNLLSLAIDSCKSLKKLPDGLQFLTNLQELVVVRMPQTFIDRYKEGGEDHWMVQHIP 146 G+M L +L ID CK LK+LPDGL+++T+L+EL + M + + ++ GGED++ VQHIP Sbjct: 840 GSMPCLRTLTIDDCKKLKELPDGLKYITSLKELKIEGMKREWKEKLVPGGEDYYKVQHIP 899 >dbj|BAF01738.1| disease resistance protein RPP8 [Arabidopsis thaliana] Length = 555 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/60 (48%), Positives = 44/60 (73%) Frame = -2 Query: 325 GTMRNLLSLAIDSCKSLKKLPDGLQFLTNLQELVVVRMPQTFIDRYKEGGEDHWMVQHIP 146 G+M L +L ID CK LK+LPDGL+++T+L+EL + M + + ++ GGED++ VQHIP Sbjct: 487 GSMPCLRTLTIDDCKKLKELPDGLKYITSLKELKIEGMKREWKEKLVPGGEDYYKVQHIP 546 >ref|XP_007021585.1| CC-NBS-LRR class disease resistance protein [Theobroma cacao] gi|508721213|gb|EOY13110.1| CC-NBS-LRR class disease resistance protein [Theobroma cacao] Length = 609 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/60 (50%), Positives = 41/60 (68%) Frame = -2 Query: 325 GTMRNLLSLAIDSCKSLKKLPDGLQFLTNLQELVVVRMPQTFIDRYKEGGEDHWMVQHIP 146 G M L L I CK+LK L DGL+F+ L++L + RMP+ F D+ +EGG+D + VQHIP Sbjct: 542 GAMPALRHLEIYKCKNLKMLSDGLRFIATLRKLEIRRMPKAFKDKLEEGGDDFYKVQHIP 601