BLASTX nr result
ID: Cocculus22_contig00026001
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00026001 (456 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC06934.1| Serine/threonine-protein kinase [Morus notabilis] 61 2e-07 >gb|EXC06934.1| Serine/threonine-protein kinase [Morus notabilis] Length = 1430 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/43 (69%), Positives = 34/43 (79%), Gaps = 3/43 (6%) Frame = -3 Query: 127 MGTDQNAIPKDLRPLNIVRVVSDEPRV---QAGRSAEGFFPNP 8 M DQN+IPKDLRPLNIVR V +EPR+ AGRS EG+FPNP Sbjct: 1 MAFDQNSIPKDLRPLNIVRNVVEEPRIVQAAAGRSPEGYFPNP 43