BLASTX nr result
ID: Cocculus22_contig00025756
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00025756 (381 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EJY66653.1| hypothetical protein OXYTRI_13058 [Oxytricha trif... 59 5e-07 gb|EJY65597.1| hypothetical protein OXYTRI_14248 [Oxytricha trif... 59 5e-07 >gb|EJY66653.1| hypothetical protein OXYTRI_13058 [Oxytricha trifallax] Length = 1367 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = +3 Query: 3 KSFNPLFKVLFTFPSQYLFAIGFP*IFSLRRSLSP 107 KSF+ LFKVLF FPSQYLFAIGF IFSLRRSLSP Sbjct: 918 KSFDSLFKVLFIFPSQYLFAIGFLLIFSLRRSLSP 952 >gb|EJY65597.1| hypothetical protein OXYTRI_14248 [Oxytricha trifallax] Length = 1367 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = +3 Query: 3 KSFNPLFKVLFTFPSQYLFAIGFP*IFSLRRSLSP 107 KSF+ LFKVLF FPSQYLFAIGF IFSLRRSLSP Sbjct: 918 KSFDSLFKVLFIFPSQYLFAIGFLLIFSLRRSLSP 952