BLASTX nr result
ID: Cocculus22_contig00025518
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00025518 (347 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006852897.1| hypothetical protein AMTR_s00033p00222240 [A... 72 6e-11 >ref|XP_006852897.1| hypothetical protein AMTR_s00033p00222240 [Amborella trichopoda] gi|548856511|gb|ERN14364.1| hypothetical protein AMTR_s00033p00222240 [Amborella trichopoda] Length = 349 Score = 72.4 bits (176), Expect = 6e-11 Identities = 31/57 (54%), Positives = 41/57 (71%) Frame = +2 Query: 2 FEAMLKNNMPVNGTLYEVIITGLCRSGEMAEAHKYLNKMIEEGHLLSYIRWKLLYDS 172 F+ M+ N +PVNG+LY++II GLC+ G EAH LN+MIE G+L SY+ W L DS Sbjct: 266 FQEMINNKVPVNGSLYDIIIRGLCKIGSFQEAHMLLNEMIENGYLASYLGWSSLVDS 322