BLASTX nr result
ID: Cocculus22_contig00025152
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00025152 (377 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002316808.2| hypothetical protein POPTR_0011s06790g [Popu... 55 1e-05 >ref|XP_002316808.2| hypothetical protein POPTR_0011s06790g [Populus trichocarpa] gi|550327829|gb|EEE97420.2| hypothetical protein POPTR_0011s06790g [Populus trichocarpa] Length = 515 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -1 Query: 377 GSPSISATDILLGPLPRPPAASILYNGLHDLFQRIQR 267 GS SISA+DILLG LPRPPAA+ILY L DL+Q++ R Sbjct: 479 GSQSISASDILLGSLPRPPAAAILYRALVDLYQKLDR 515