BLASTX nr result
ID: Cocculus22_contig00024645
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00024645 (495 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002324374.2| hypothetical protein POPTR_0018s03300g [Popu... 59 5e-07 >ref|XP_002324374.2| hypothetical protein POPTR_0018s03300g [Populus trichocarpa] gi|550317936|gb|EEF02939.2| hypothetical protein POPTR_0018s03300g [Populus trichocarpa] Length = 524 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/75 (36%), Positives = 44/75 (58%), Gaps = 5/75 (6%) Frame = -3 Query: 217 PTRAPANP*AKPLPSRCYRCNQPCHRSNKCPQRQAIHL-----NTTEDLEDTSPATVDET 53 P +AP NP A+P +CY+C QP HRSN+CP+R ++L T + E T + Sbjct: 7 PPKAPRNPYARPNSDKCYQCGQPGHRSNQCPKRGVVNLIGAGEETDLEAEGVEDETANTY 66 Query: 52 EDLKIVEGDEGDAIT 8 ++ +I GD+G+ ++ Sbjct: 67 KEDEITGGDDGELLS 81