BLASTX nr result
ID: Cocculus22_contig00024498
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00024498 (328 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB97350.1| putative receptor-like protein kinase [Morus nota... 56 5e-06 >gb|EXB97350.1| putative receptor-like protein kinase [Morus notabilis] Length = 663 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +3 Query: 3 PLPLGHQSFYSNENTFSISPCLSGQQLNTGDLLR 104 P+PLGH SFYS+ +TFSISP LSG QL+TGD+LR Sbjct: 630 PMPLGHPSFYSDFSTFSISPALSGPQLHTGDMLR 663