BLASTX nr result
ID: Cocculus22_contig00024471
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00024471 (438 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007021219.1| S-locus lectin protein kinase family protein... 60 4e-07 ref|XP_004295873.1| PREDICTED: uncharacterized protein LOC101296... 58 2e-06 >ref|XP_007021219.1| S-locus lectin protein kinase family protein, putative [Theobroma cacao] gi|508720847|gb|EOY12744.1| S-locus lectin protein kinase family protein, putative [Theobroma cacao] Length = 852 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +2 Query: 2 YMPNKSLDHFIFDQDRGKLLAWQKRFDIIMRI 97 YMPNKSLD+FIFD DR LLAWQKRFDIIM+I Sbjct: 610 YMPNKSLDYFIFDHDRRVLLAWQKRFDIIMQI 641 >ref|XP_004295873.1| PREDICTED: uncharacterized protein LOC101296759 [Fragaria vesca subsp. vesca] Length = 3273 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +2 Query: 2 YMPNKSLDHFIFDQDRGKLLAWQKRFDIIMRI 97 YMPNKSLD FIFDQ+R KLL WQKRFDIIM I Sbjct: 3030 YMPNKSLDFFIFDQNRKKLLNWQKRFDIIMGI 3061