BLASTX nr result
ID: Cocculus22_contig00024068
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00024068 (531 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006576269.1| PREDICTED: PDR-like ABC-transporter isoform ... 46 2e-07 gb|AGT28055.1| pleiotropic drug resistance transporter 3 [Panax ... 45 2e-07 ref|XP_007162619.1| hypothetical protein PHAVU_001G166400g, part... 45 2e-07 ref|XP_006646084.1| PREDICTED: pleiotropic drug resistance prote... 46 3e-07 ref|XP_007200951.1| hypothetical protein PRUPE_ppa000265mg [Prun... 44 3e-07 ref|XP_004493879.1| PREDICTED: pleiotropic drug resistance prote... 46 3e-07 ref|XP_004245225.1| PREDICTED: pleiotropic drug resistance prote... 44 4e-07 ref|NP_001237697.1| PDR-like ABC-transporter [Glycine max] gi|94... 45 4e-07 ref|NP_001043539.1| Os01g0609300 [Oryza sativa Japonica Group] g... 45 5e-07 sp|A2WSH0.1|PDR3_ORYSI RecName: Full=Pleiotropic drug resistance... 45 5e-07 gb|AAQ02685.1| PDR-type ABC transporter 9 [Oryza sativa Indica G... 45 5e-07 ref|XP_006368914.1| hypothetical protein POPTR_0001s14650g, part... 44 5e-07 ref|XP_003625403.1| Pleiotropic drug resistance protein [Medicag... 45 5e-07 gb|EAZ12646.1| hypothetical protein OsJ_02561 [Oryza sativa Japo... 45 5e-07 ref|XP_007162608.1| hypothetical protein PHAVU_001G165700g [Phas... 45 6e-07 ref|XP_007013787.1| Pleiotropic drug resistance 12 [Theobroma ca... 44 8e-07 ref|XP_006416897.1| hypothetical protein EUTSA_v10006564mg [Eutr... 45 8e-07 ref|XP_006476213.1| PREDICTED: pleiotropic drug resistance prote... 42 1e-06 ref|XP_006366078.1| PREDICTED: pleiotropic drug resistance prote... 42 1e-06 ref|XP_006476214.1| PREDICTED: pleiotropic drug resistance prote... 42 1e-06 >ref|XP_006576269.1| PREDICTED: PDR-like ABC-transporter isoform X1 [Glycine max] Length = 1474 Score = 46.2 bits (108), Expect(2) = 2e-07 Identities = 20/41 (48%), Positives = 28/41 (68%) Frame = +1 Query: 181 VLVELHYTLVQAVVYRLIVHATLGFHWTLASQVLMVLFLQF 303 VL+EL Y LVQAVVY +I++A +GF WT+ + F+ F Sbjct: 1302 VLIELPYVLVQAVVYGIIIYAMIGFEWTVTKVFWYLFFMYF 1342 Score = 34.7 bits (78), Expect(2) = 2e-07 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = +2 Query: 26 ERGVFYRERAVGLYSALLYTF 88 ER VFYRE+A G+YSAL Y F Sbjct: 1279 ERTVFYREKAAGMYSALPYAF 1299 >gb|AGT28055.1| pleiotropic drug resistance transporter 3 [Panax ginseng] Length = 1378 Score = 45.1 bits (105), Expect(2) = 2e-07 Identities = 22/49 (44%), Positives = 33/49 (67%) Frame = +1 Query: 181 VLVELHYTLVQAVVYRLIVHATLGFHWTLASQVLMVLFLQFLHIPLLQF 327 VLVE+ Y VQAVVY ++V++ +GF WT+A +L F+++ LL F Sbjct: 1207 VLVEVPYVFVQAVVYSVMVYSMIGFEWTVAK---FCWYLFFMYVTLLYF 1252 Score = 35.8 bits (81), Expect(2) = 2e-07 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +2 Query: 26 ERGVFYRERAVGLYSALLYTF 88 ER VFYRERA G+YSAL Y F Sbjct: 1184 ERTVFYRERAAGMYSALPYAF 1204 >ref|XP_007162619.1| hypothetical protein PHAVU_001G166400g, partial [Phaseolus vulgaris] gi|561036083|gb|ESW34613.1| hypothetical protein PHAVU_001G166400g, partial [Phaseolus vulgaris] Length = 1088 Score = 45.1 bits (105), Expect(2) = 2e-07 Identities = 19/41 (46%), Positives = 29/41 (70%) Frame = +1 Query: 181 VLVELHYTLVQAVVYRLIVHATLGFHWTLASQVLMVLFLQF 303 VL+EL Y LVQAVVY +I++A +G+ WT+ + + F+ F Sbjct: 953 VLIELPYVLVQAVVYSIIIYAMVGYEWTVPKFLWCLFFMYF 993 Score = 35.8 bits (81), Expect(2) = 2e-07 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = +2 Query: 20 TFERGVFYRERAVGLYSALLYTF 88 T ER VFYRERA G+YSA Y F Sbjct: 928 TVERTVFYRERAAGMYSAFPYAF 950 >ref|XP_006646084.1| PREDICTED: pleiotropic drug resistance protein 3-like [Oryza brachyantha] Length = 1463 Score = 45.8 bits (107), Expect(2) = 3e-07 Identities = 21/41 (51%), Positives = 28/41 (68%) Frame = +1 Query: 181 VLVELHYTLVQAVVYRLIVHATLGFHWTLASQVLMVLFLQF 303 V++EL YTLVQA VY +IV+A +GF WT A + F+ F Sbjct: 1294 VVIELPYTLVQATVYGIIVYAMIGFEWTAAKFFWYLFFMVF 1334 Score = 34.3 bits (77), Expect(2) = 3e-07 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = +2 Query: 26 ERGVFYRERAVGLYSALLYTF 88 ER VFYRERA G+YSA Y F Sbjct: 1271 ERTVFYRERAAGMYSAFPYAF 1291 >ref|XP_007200951.1| hypothetical protein PRUPE_ppa000265mg [Prunus persica] gi|462396351|gb|EMJ02150.1| hypothetical protein PRUPE_ppa000265mg [Prunus persica] Length = 1374 Score = 43.5 bits (101), Expect(2) = 3e-07 Identities = 18/41 (43%), Positives = 27/41 (65%) Frame = +1 Query: 181 VLVELHYTLVQAVVYRLIVHATLGFHWTLASQVLMVLFLQF 303 V +E+ Y QAV+Y +IV+A +GF WTLA + + F+ F Sbjct: 1205 VTIEIPYVFAQAVIYSVIVYAMIGFEWTLAKFLWYLFFMYF 1245 Score = 36.6 bits (83), Expect(2) = 3e-07 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +2 Query: 26 ERGVFYRERAVGLYSALLYTF 88 ER VFYRERA G+YSAL Y F Sbjct: 1182 ERTVFYRERAAGMYSALAYAF 1202 >ref|XP_004493879.1| PREDICTED: pleiotropic drug resistance protein 1-like, partial [Cicer arietinum] Length = 1365 Score = 45.8 bits (107), Expect(2) = 3e-07 Identities = 20/41 (48%), Positives = 28/41 (68%) Frame = +1 Query: 181 VLVELHYTLVQAVVYRLIVHATLGFHWTLASQVLMVLFLQF 303 V++EL Y VQAVVY IV+A +GF WT+A + + F+ F Sbjct: 1193 VIIELPYVFVQAVVYGFIVYAMIGFEWTVAKFLWFLFFMYF 1233 Score = 34.3 bits (77), Expect(2) = 3e-07 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = +2 Query: 26 ERGVFYRERAVGLYSALLYTF 88 ER VFYRERA G+YSA Y F Sbjct: 1170 ERTVFYRERAAGMYSAFPYAF 1190 >ref|XP_004245225.1| PREDICTED: pleiotropic drug resistance protein 1-like [Solanum lycopersicum] Length = 1453 Score = 43.9 bits (102), Expect(2) = 4e-07 Identities = 18/49 (36%), Positives = 32/49 (65%) Frame = +1 Query: 181 VLVELHYTLVQAVVYRLIVHATLGFHWTLASQVLMVLFLQFLHIPLLQF 327 +++EL Y +Q ++Y +IV+A +GF WT+A + +L F++ LL F Sbjct: 1284 IMIELPYIFIQTIIYGVIVYAMIGFEWTVAK---FIWYLFFMYFTLLYF 1329 Score = 35.8 bits (81), Expect(2) = 4e-07 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +2 Query: 26 ERGVFYRERAVGLYSALLYTF 88 ER VFYRERA G+YSAL Y F Sbjct: 1261 ERTVFYRERAAGMYSALPYAF 1281 >ref|NP_001237697.1| PDR-like ABC-transporter [Glycine max] gi|94732079|emb|CAK03587.1| PDR-like ABC-transporter [Glycine max] Length = 1447 Score = 45.1 bits (105), Expect(2) = 4e-07 Identities = 20/41 (48%), Positives = 27/41 (65%) Frame = +1 Query: 181 VLVELHYTLVQAVVYRLIVHATLGFHWTLASQVLMVLFLQF 303 VL+EL Y LVQAVVY +I++A +GF WT+ F+ F Sbjct: 1275 VLIELPYVLVQAVVYGIIIYAMIGFEWTVTKVFWYQFFMYF 1315 Score = 34.7 bits (78), Expect(2) = 4e-07 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = +2 Query: 26 ERGVFYRERAVGLYSALLYTF 88 ER VFYRE+A G+YSAL Y F Sbjct: 1252 ERTVFYREKAAGMYSALPYAF 1272 >ref|NP_001043539.1| Os01g0609300 [Oryza sativa Japonica Group] gi|122241165|sp|Q0JLC5.1|PDR3_ORYSJ RecName: Full=Pleiotropic drug resistance protein 3 gi|27368821|emb|CAD59568.1| PDR-like ABC transporter [Oryza sativa Japonica Group] gi|28144343|tpg|DAA00886.1| TPA_exp: PDR3 ABC transporter [Oryza sativa (japonica cultivar-group)] gi|113533070|dbj|BAF05453.1| Os01g0609300 [Oryza sativa Japonica Group] Length = 1457 Score = 45.1 bits (105), Expect(2) = 5e-07 Identities = 20/41 (48%), Positives = 28/41 (68%) Frame = +1 Query: 181 VLVELHYTLVQAVVYRLIVHATLGFHWTLASQVLMVLFLQF 303 V++E+ YTLVQA VY +IV+A +GF WT A + F+ F Sbjct: 1288 VVIEIPYTLVQATVYGIIVYAMIGFEWTAAKFFWYLFFMVF 1328 Score = 34.3 bits (77), Expect(2) = 5e-07 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = +2 Query: 26 ERGVFYRERAVGLYSALLYTF 88 ER VFYRERA G+YSA Y F Sbjct: 1265 ERTVFYRERAAGMYSAFPYAF 1285 >sp|A2WSH0.1|PDR3_ORYSI RecName: Full=Pleiotropic drug resistance protein 3; AltName: Full=OsPDR9 gi|125526802|gb|EAY74916.1| hypothetical protein OsI_02810 [Oryza sativa Indica Group] Length = 1457 Score = 45.1 bits (105), Expect(2) = 5e-07 Identities = 20/41 (48%), Positives = 28/41 (68%) Frame = +1 Query: 181 VLVELHYTLVQAVVYRLIVHATLGFHWTLASQVLMVLFLQF 303 V++E+ YTLVQA VY +IV+A +GF WT A + F+ F Sbjct: 1288 VVIEIPYTLVQATVYGIIVYAMIGFEWTAAKFFWYLFFMVF 1328 Score = 34.3 bits (77), Expect(2) = 5e-07 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = +2 Query: 26 ERGVFYRERAVGLYSALLYTF 88 ER VFYRERA G+YSA Y F Sbjct: 1265 ERTVFYRERAAGMYSAFPYAF 1285 >gb|AAQ02685.1| PDR-type ABC transporter 9 [Oryza sativa Indica Group] Length = 1457 Score = 45.1 bits (105), Expect(2) = 5e-07 Identities = 20/41 (48%), Positives = 28/41 (68%) Frame = +1 Query: 181 VLVELHYTLVQAVVYRLIVHATLGFHWTLASQVLMVLFLQF 303 V++E+ YTLVQA VY +IV+A +GF WT A + F+ F Sbjct: 1288 VVIEIPYTLVQATVYGIIVYAMIGFEWTAAKFFWYLFFMVF 1328 Score = 34.3 bits (77), Expect(2) = 5e-07 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = +2 Query: 26 ERGVFYRERAVGLYSALLYTF 88 ER VFYRERA G+YSA Y F Sbjct: 1265 ERTVFYRERAAGMYSAFPYAF 1285 >ref|XP_006368914.1| hypothetical protein POPTR_0001s14650g, partial [Populus trichocarpa] gi|550347260|gb|ERP65483.1| hypothetical protein POPTR_0001s14650g, partial [Populus trichocarpa] Length = 1457 Score = 43.5 bits (101), Expect(2) = 5e-07 Identities = 22/51 (43%), Positives = 31/51 (60%) Frame = +1 Query: 181 VLVELHYTLVQAVVYRLIVHATLGFHWTLASQVLMVLFLQFLHIPLLQFLW 333 VL+EL Y QA VY +IV+A +GF WT+A +L F++ LL F + Sbjct: 1288 VLIELPYIFAQAAVYGIIVYAMIGFDWTVAK---FFWYLFFMYFTLLYFTY 1335 Score = 35.8 bits (81), Expect(2) = 5e-07 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +2 Query: 26 ERGVFYRERAVGLYSALLYTF 88 ER VFYRERA G+YSAL Y F Sbjct: 1265 ERTVFYRERAAGMYSALPYAF 1285 >ref|XP_003625403.1| Pleiotropic drug resistance protein [Medicago truncatula] gi|355500418|gb|AES81621.1| Pleiotropic drug resistance protein [Medicago truncatula] Length = 1440 Score = 45.1 bits (105), Expect(2) = 5e-07 Identities = 18/43 (41%), Positives = 30/43 (69%) Frame = +1 Query: 175 MWVLVELHYTLVQAVVYRLIVHATLGFHWTLASQVLMVLFLQF 303 M+ L+E+ Y LVQAVVY ++V+A +G+ W++ V + F+ F Sbjct: 1266 MYALIEIPYNLVQAVVYGILVYAMIGYEWSVTKFVWYIFFMFF 1308 Score = 34.3 bits (77), Expect(2) = 5e-07 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = +2 Query: 26 ERGVFYRERAVGLYSALLYTFFNRAI 103 ER VFYRERA G+YSAL Y +I Sbjct: 1231 ERVVFYRERAAGMYSALAYAVSQASI 1256 >gb|EAZ12646.1| hypothetical protein OsJ_02561 [Oryza sativa Japonica Group] Length = 1372 Score = 45.1 bits (105), Expect(2) = 5e-07 Identities = 20/41 (48%), Positives = 28/41 (68%) Frame = +1 Query: 181 VLVELHYTLVQAVVYRLIVHATLGFHWTLASQVLMVLFLQF 303 V++E+ YTLVQA VY +IV+A +GF WT A + F+ F Sbjct: 1203 VVIEIPYTLVQATVYGIIVYAMIGFEWTAAKFFWYLFFMVF 1243 Score = 34.3 bits (77), Expect(2) = 5e-07 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = +2 Query: 26 ERGVFYRERAVGLYSALLYTF 88 ER VFYRERA G+YSA Y F Sbjct: 1180 ERTVFYRERAAGMYSAFPYAF 1200 >ref|XP_007162608.1| hypothetical protein PHAVU_001G165700g [Phaseolus vulgaris] gi|561036072|gb|ESW34602.1| hypothetical protein PHAVU_001G165700g [Phaseolus vulgaris] Length = 1456 Score = 45.1 bits (105), Expect(2) = 6e-07 Identities = 19/41 (46%), Positives = 28/41 (68%) Frame = +1 Query: 181 VLVELHYTLVQAVVYRLIVHATLGFHWTLASQVLMVLFLQF 303 V++EL Y L QAVVY +I++A +GF WT+A + F+ F Sbjct: 1284 VVIELPYVLAQAVVYGIIIYAMIGFEWTVAKVFWYLFFMYF 1324 Score = 33.9 bits (76), Expect(2) = 6e-07 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = +2 Query: 26 ERGVFYRERAVGLYSALLYTF 88 ER VFYRE+A G+YSAL Y F Sbjct: 1261 ERTVFYREKASGMYSALPYAF 1281 >ref|XP_007013787.1| Pleiotropic drug resistance 12 [Theobroma cacao] gi|508784150|gb|EOY31406.1| Pleiotropic drug resistance 12 [Theobroma cacao] Length = 1447 Score = 43.9 bits (102), Expect(2) = 8e-07 Identities = 22/49 (44%), Positives = 34/49 (69%) Frame = +1 Query: 181 VLVELHYTLVQAVVYRLIVHATLGFHWTLASQVLMVLFLQFLHIPLLQF 327 V++EL YTL+Q ++Y +IV+A +GF WT AS+ LF F++ LL + Sbjct: 1278 VVIELPYTLIQTLIYGVIVYAMIGFEWT-ASKFFWYLF--FMYFTLLYY 1323 Score = 34.7 bits (78), Expect(2) = 8e-07 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = +2 Query: 26 ERGVFYRERAVGLYSALLYTF 88 ER VFYRE+A G+YSAL Y F Sbjct: 1255 ERTVFYREKAAGMYSALPYAF 1275 >ref|XP_006416897.1| hypothetical protein EUTSA_v10006564mg [Eutrema salsugineum] gi|557094668|gb|ESQ35250.1| hypothetical protein EUTSA_v10006564mg [Eutrema salsugineum] Length = 1420 Score = 44.7 bits (104), Expect(2) = 8e-07 Identities = 24/49 (48%), Positives = 31/49 (63%) Frame = +1 Query: 181 VLVELHYTLVQAVVYRLIVHATLGFHWTLASQVLMVLFLQFLHIPLLQF 327 V +E+ Y LVQAVVY LIV+A +GF WT A +L F++ LL F Sbjct: 1251 VFIEMPYVLVQAVVYGLIVYAMIGFEWTAAK---FFWYLFFMYGSLLTF 1296 Score = 33.9 bits (76), Expect(2) = 8e-07 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 26 ERGVFYRERAVGLYSALLYTF 88 ER VFYRE+A G+YSA+ Y F Sbjct: 1228 ERTVFYREKAAGMYSAMPYAF 1248 >ref|XP_006476213.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform X1 [Citrus sinensis] Length = 1463 Score = 42.4 bits (98), Expect(2) = 1e-06 Identities = 19/48 (39%), Positives = 34/48 (70%), Gaps = 2/48 (4%) Frame = +1 Query: 181 VLVELHYTLVQAVVYRLIVHATLGFHWTLASQV--LMVLFLQFLHIPL 318 V++EL + +QAV+Y +IV+A +GF WT++ + L+ ++L FL+ L Sbjct: 1294 VVIELPHIFIQAVIYGVIVYAMIGFDWTVSKFLWYLLFMYLTFLYFTL 1341 Score = 35.8 bits (81), Expect(2) = 1e-06 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +2 Query: 26 ERGVFYRERAVGLYSALLYTF 88 ER VFYRERA G+YSAL Y F Sbjct: 1271 ERTVFYRERAAGMYSALPYAF 1291 >ref|XP_006366078.1| PREDICTED: pleiotropic drug resistance protein 1-like [Solanum tuberosum] Length = 1453 Score = 42.4 bits (98), Expect(2) = 1e-06 Identities = 18/49 (36%), Positives = 31/49 (63%) Frame = +1 Query: 181 VLVELHYTLVQAVVYRLIVHATLGFHWTLASQVLMVLFLQFLHIPLLQF 327 +++EL Y +Q ++Y +IV+A +GF WT+A +L F++ LL F Sbjct: 1284 IMIELPYIFIQTIIYGVIVYAMIGFEWTVAK---FFWYLFFMYFTLLYF 1329 Score = 35.8 bits (81), Expect(2) = 1e-06 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +2 Query: 26 ERGVFYRERAVGLYSALLYTF 88 ER VFYRERA G+YSAL Y F Sbjct: 1261 ERTVFYRERAAGMYSALPYAF 1281 >ref|XP_006476214.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform X2 [Citrus sinensis] Length = 1452 Score = 42.4 bits (98), Expect(2) = 1e-06 Identities = 19/48 (39%), Positives = 34/48 (70%), Gaps = 2/48 (4%) Frame = +1 Query: 181 VLVELHYTLVQAVVYRLIVHATLGFHWTLASQV--LMVLFLQFLHIPL 318 V++EL + +QAV+Y +IV+A +GF WT++ + L+ ++L FL+ L Sbjct: 1283 VVIELPHIFIQAVIYGVIVYAMIGFDWTVSKFLWYLLFMYLTFLYFTL 1330 Score = 35.8 bits (81), Expect(2) = 1e-06 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = +2 Query: 26 ERGVFYRERAVGLYSALLYTF 88 ER VFYRERA G+YSAL Y F Sbjct: 1260 ERTVFYRERAAGMYSALPYAF 1280